Cla97C06G114140 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAAGTCGAAGAATCACACAGCTCACAATCAGTCACGCAAAGCCCATAAGAATGGCATCAAGAAACCAAGGAAGCACCGCCACACTTCCACCAAAGGGGTATGTGTTTAACTCAAACAGTTACTTCTGTTCTTGTTCAATCCATTTTTTTTCCTTTTTTAATTGTTTTAATTATTTGCTTCGTCGATTTGTCGATTTGTGTTTAGATGGATCCGAAGTTCCTTAGGAACCAGAGGTACGCGAAGAAACACAATAACAAGAGTGGGGAAAATGCGTCTGAAGAAGAGTAA ATGGCGAAGTCGAAGAATCACACAGCTCACAATCAGTCACGCAAAGCCCATAAGAATGGCATCAAGAAACCAAGGAAGCACCGCCACACTTCCACCAAAGGGATGGATCCGAAGTTCCTTAGGAACCAGAGGTACGCGAAGAAACACAATAACAAGAGTGGGGAAAATGCGTCTGAAGAAGAGTAA ATGGCGAAGTCGAAGAATCACACAGCTCACAATCAGTCACGCAAAGCCCATAAGAATGGCATCAAGAAACCAAGGAAGCACCGCCACACTTCCACCAAAGGGATGGATCCGAAGTTCCTTAGGAACCAGAGGTACGCGAAGAAACACAATAACAAGAGTGGGGAAAATGCGTCTGAAGAAGAGTAA MAKSKNHTAHNQSRKAHKNGIKKPRKHRHTSTKGMDPKFLRNQRYAKKHNNKSGENASEEE
BLAST of Cla97C06G114140 vs. NCBI nr
Match: XP_023000055.1 (60S ribosomal protein L29-1 [Cucurbita maxima] >XP_023514069.1 60S ribosomal protein L29-1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 114.4 bits (285), Expect = 1.4e-22 Identity = 59/61 (96.72%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C06G114140 vs. NCBI nr
Match: XP_022930218.1 (60S ribosomal protein L29-1 [Cucurbita moschata]) HSP 1 Score: 113.2 bits (282), Expect = 3.1e-22 Identity = 58/60 (96.67%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of Cla97C06G114140 vs. NCBI nr
Match: XP_022959482.1 (60S ribosomal protein L29-1-like [Cucurbita moschata] >XP_022959483.1 60S ribosomal protein L29-1-like [Cucurbita moschata] >XP_023006357.1 60S ribosomal protein L29-1-like [Cucurbita maxima] >XP_023006358.1 60S ribosomal protein L29-1-like [Cucurbita maxima] >XP_023549485.1 60S ribosomal protein L29-1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 112.8 bits (281), Expect = 4.0e-22 Identity = 58/61 (95.08%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of Cla97C06G114140 vs. NCBI nr
Match: XP_008458371.1 (PREDICTED: 60S ribosomal protein L29-1-like [Cucumis melo]) HSP 1 Score: 112.5 bits (280), Expect = 5.2e-22 Identity = 59/61 (96.72%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of Cla97C06G114140 vs. NCBI nr
Match: XP_023000056.1 (60S ribosomal protein L29-1-like [Cucurbita maxima]) HSP 1 Score: 112.1 bits (279), Expect = 6.8e-22 Identity = 57/61 (93.44%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C06G114140 vs. TrEMBL
Match: tr|A0A1S3C7P2|A0A1S3C7P2_CUCME (60S ribosomal protein L29 OS=Cucumis melo OX=3656 GN=LOC103497798 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 3.4e-22 Identity = 59/61 (96.72%), Postives = 59/61 (96.72%), Query Frame = 0
BLAST of Cla97C06G114140 vs. TrEMBL
Match: tr|A0A2R6PJK9|A0A2R6PJK9_ACTCH (60S ribosomal protein L29 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc27140 PE=3 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 1.0e-21 Identity = 57/61 (93.44%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C06G114140 vs. TrEMBL
Match: tr|A0A0A0KCX6|A0A0A0KCX6_CUCSA (60S ribosomal protein L29 OS=Cucumis sativus OX=3659 GN=Csa_6G309950 PE=3 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 1.0e-21 Identity = 58/61 (95.08%), Postives = 58/61 (95.08%), Query Frame = 0
BLAST of Cla97C06G114140 vs. TrEMBL
Match: tr|A0A1S3C7U0|A0A1S3C7U0_CUCME (60S ribosomal protein L29 OS=Cucumis melo OX=3656 GN=LOC103497797 PE=3 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.7e-21 Identity = 58/61 (95.08%), Postives = 58/61 (95.08%), Query Frame = 0
BLAST of Cla97C06G114140 vs. TrEMBL
Match: tr|Q9MAW5|Q9MAW5_PANGI (60S ribosomal protein L29 OS=Panax ginseng OX=4054 GN=RPL29 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 6.5e-21 Identity = 54/61 (88.52%), Postives = 60/61 (98.36%), Query Frame = 0
BLAST of Cla97C06G114140 vs. Swiss-Prot
Match: sp|Q9M7X7|RL291_ARATH (60S ribosomal protein L29-1 OS=Arabidopsis thaliana OX=3702 GN=RPL29A PE=1 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.0e-21 Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of Cla97C06G114140 vs. Swiss-Prot
Match: sp|Q84WM0|RL292_ARATH (60S ribosomal protein L29-2 OS=Arabidopsis thaliana OX=3702 GN=RPL29B PE=3 SV=2) HSP 1 Score: 102.4 bits (254), Expect = 1.8e-21 Identity = 53/61 (86.89%), Postives = 56/61 (91.80%), Query Frame = 0
BLAST of Cla97C06G114140 vs. Swiss-Prot
Match: sp|Q58DW3|RL29_BOVIN (60S ribosomal protein L29 OS=Bos taurus OX=9913 GN=RPL29 PE=2 SV=3) HSP 1 Score: 78.6 bits (192), Expect = 2.7e-14 Identity = 40/52 (76.92%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of Cla97C06G114140 vs. Swiss-Prot
Match: sp|P47914|RL29_HUMAN (60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2) HSP 1 Score: 78.6 bits (192), Expect = 2.7e-14 Identity = 40/52 (76.92%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of Cla97C06G114140 vs. Swiss-Prot
Match: sp|Q8HXB8|RL29_MACFA (60S ribosomal protein L29 OS=Macaca fascicularis OX=9541 GN=RPL29 PE=2 SV=3) HSP 1 Score: 78.6 bits (192), Expect = 2.7e-14 Identity = 40/52 (76.92%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of Cla97C06G114140 vs. TAIR10
Match: AT3G06700.1 (Ribosomal L29e protein family) HSP 1 Score: 103.2 bits (256), Expect = 5.7e-23 Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of Cla97C06G114140 vs. TAIR10
Match: AT3G06680.1 (Ribosomal L29e protein family) HSP 1 Score: 102.4 bits (254), Expect = 9.8e-23 Identity = 53/61 (86.89%), Postives = 56/61 (91.80%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |