Cla97C05G100920 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGTTAGCCAGTATGGCCCATATTGGCGCCATATTCGCAAAATAATCACACTCGAACTCCTCACAAACCACCGCCTCGAGCAGTGCCAACACATTAGAATATCCGAGGTTCAAACTTCGATCAAGAAACTGTATGAGTTATGTGGGGATGGCAGAAATAATAACAAGGGAACAATGGAGATGAAGACGTGGTTTGAGGAGCTAAAAATGAGTATAATATTGAGGATAATGGTAGGAAAGCGATTCAGCTCGGCTTTTGAAGGCAGTGTTGGGGAGCAGTTTCGAGGAGCGTTGAGGGATCTTCTTTATCTGTTTGGGGCATTTGTTCCTTCAGATTCTTTCCGTTTCTAA ATGGAGGTTAGCCAGTATGGCCCATATTGGCGCCATATTCGCAAAATAATCACACTCGAACTCCTCACAAACCACCGCCTCGAGCAGTGCCAACACATTAGAATATCCGAGGTTCAAACTTCGATCAAGAAACTGTATGAGTTATGTGGGGATGGCAGAAATAATAACAAGGGAACAATGGAGATGAAGACGTGGTTTGAGGAGCTAAAAATGAGTATAATATTGAGGATAATGGTAGGAAAGCGATTCAGCTCGGCTTTTGAAGGCAGTGTTGGGGAGCAGTTTCGAGGAGCGTTGAGGGATCTTCTTTATCTGTTTGGGGCATTTGTTCCTTCAGATTCTTTCCGTTTCTAA ATGGAGGTTAGCCAGTATGGCCCATATTGGCGCCATATTCGCAAAATAATCACACTCGAACTCCTCACAAACCACCGCCTCGAGCAGTGCCAACACATTAGAATATCCGAGGTTCAAACTTCGATCAAGAAACTGTATGAGTTATGTGGGGATGGCAGAAATAATAACAAGGGAACAATGGAGATGAAGACGTGGTTTGAGGAGCTAAAAATGAGTATAATATTGAGGATAATGGTAGGAAAGCGATTCAGCTCGGCTTTTGAAGGCAGTGTTGGGGAGCAGTTTCGAGGAGCGTTGAGGGATCTTCTTTATCTGTTTGGGGCATTTGTTCCTTCAGATTCTTTCCGTTTCTAA MEVSQYGPYWRHIRKIITLELLTNHRLEQCQHIRISEVQTSIKKLYELCGDGRNNNKGTMEMKTWFEELKMSIILRIMVGKRFSSAFEGSVGEQFRGALRDLLYLFGAFVPSDSFRF
BLAST of Cla97C05G100920 vs. NCBI nr
Match: XP_022935741.1 (cytochrome P450 CYP82D47-like [Cucurbita moschata]) HSP 1 Score: 165.6 bits (418), Expect = 1.0e-37 Identity = 79/118 (66.95%), Postives = 94/118 (79.66%), Query Frame = 0
BLAST of Cla97C05G100920 vs. NCBI nr
Match: XP_022975796.1 (cytochrome P450 82A3-like [Cucurbita maxima]) HSP 1 Score: 164.5 bits (415), Expect = 2.2e-37 Identity = 78/118 (66.10%), Postives = 94/118 (79.66%), Query Frame = 0
BLAST of Cla97C05G100920 vs. NCBI nr
Match: XP_023535446.1 (cytochrome P450 CYP82D47-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 163.3 bits (412), Expect = 4.9e-37 Identity = 79/118 (66.95%), Postives = 94/118 (79.66%), Query Frame = 0
BLAST of Cla97C05G100920 vs. NCBI nr
Match: XP_023516810.1 (cytochrome P450 CYP82D47-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 162.5 bits (410), Expect = 8.4e-37 Identity = 79/115 (68.70%), Postives = 92/115 (80.00%), Query Frame = 0
BLAST of Cla97C05G100920 vs. NCBI nr
Match: XP_022988070.1 (cytochrome P450 CYP82D47-like [Cucurbita maxima]) HSP 1 Score: 157.5 bits (397), Expect = 2.7e-35 Identity = 78/118 (66.10%), Postives = 93/118 (78.81%), Query Frame = 0
BLAST of Cla97C05G100920 vs. TrEMBL
Match: tr|A0A0A0LG04|A0A0A0LG04_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G852630 PE=3 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 2.5e-29 Identity = 68/120 (56.67%), Postives = 89/120 (74.17%), Query Frame = 0
BLAST of Cla97C05G100920 vs. TrEMBL
Match: tr|A0A1S3CM78|A0A1S3CM78_CUCME (cytochrome P450 CYP82D47-like OS=Cucumis melo OX=3656 GN=LOC103502573 PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 1.6e-28 Identity = 66/117 (56.41%), Postives = 87/117 (74.36%), Query Frame = 0
BLAST of Cla97C05G100920 vs. TrEMBL
Match: tr|A0A1S3CMB9|A0A1S3CMB9_CUCME (cytochrome P450 CYP82D47-like OS=Cucumis melo OX=3656 GN=LOC103502574 PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 1.6e-28 Identity = 70/117 (59.83%), Postives = 82/117 (70.09%), Query Frame = 0
BLAST of Cla97C05G100920 vs. TrEMBL
Match: tr|A0A0A0LD49|A0A0A0LD49_CUCSA (Cytochrome P450 OS=Cucumis sativus OX=3659 GN=Csa_3G852640 PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 1.6e-28 Identity = 70/117 (59.83%), Postives = 82/117 (70.09%), Query Frame = 0
BLAST of Cla97C05G100920 vs. TrEMBL
Match: tr|A0A0A0LGF6|A0A0A0LGF6_CUCSA (Cytochrome P450 OS=Cucumis sativus OX=3659 GN=Csa_3G852610 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 2.0e-26 Identity = 60/114 (52.63%), Postives = 83/114 (72.81%), Query Frame = 0
BLAST of Cla97C05G100920 vs. Swiss-Prot
Match: sp|O49858|C82A3_SOYBN (Cytochrome P450 82A3 OS=Glycine max OX=3847 GN=CYP82A3 PE=2 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.6e-18 Identity = 45/116 (38.79%), Postives = 74/116 (63.79%), Query Frame = 0
BLAST of Cla97C05G100920 vs. Swiss-Prot
Match: sp|O49859|C82A4_SOYBN (Cytochrome P450 82A4 OS=Glycine max OX=3847 GN=CYP82A4 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 5.1e-17 Identity = 46/117 (39.32%), Postives = 75/117 (64.10%), Query Frame = 0
BLAST of Cla97C05G100920 vs. Swiss-Prot
Match: sp|Q43068|C82A1_PEA (Cytochrome P450 82A1 (Fragment) OS=Pisum sativum OX=3888 GN=CYP82A1 PE=2 SV=2) HSP 1 Score: 86.7 bits (213), Expect = 1.9e-16 Identity = 50/135 (37.04%), Postives = 75/135 (55.56%), Query Frame = 0
BLAST of Cla97C05G100920 vs. Swiss-Prot
Match: sp|H2DH23|C7H23_PANGI (Cytochrome P450 CYP82H23 (Fragment) OS=Panax ginseng OX=4054 PE=2 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 4.3e-16 Identity = 45/111 (40.54%), Postives = 71/111 (63.96%), Query Frame = 0
BLAST of Cla97C05G100920 vs. Swiss-Prot
Match: sp|O81972|C82A2_SOYBN (Cytochrome P450 82A2 OS=Glycine max OX=3847 GN=CYP82A2 PE=2 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 4.7e-15 Identity = 40/86 (46.51%), Postives = 58/86 (67.44%), Query Frame = 0
BLAST of Cla97C05G100920 vs. TAIR10
Match: AT4G31940.1 (cytochrome P450, family 82, subfamily C, polypeptide 4) HSP 1 Score: 82.0 bits (201), Expect = 2.6e-16 Identity = 40/117 (34.19%), Postives = 67/117 (57.26%), Query Frame = 0
BLAST of Cla97C05G100920 vs. TAIR10
Match: AT4G31970.1 (cytochrome P450, family 82, subfamily C, polypeptide 2) HSP 1 Score: 79.3 bits (194), Expect = 1.7e-15 Identity = 37/115 (32.17%), Postives = 67/115 (58.26%), Query Frame = 0
BLAST of Cla97C05G100920 vs. TAIR10
Match: AT3G25180.1 (cytochrome P450, family 82, subfamily G, polypeptide 1) HSP 1 Score: 74.3 bits (181), Expect = 5.5e-14 Identity = 42/105 (40.00%), Postives = 59/105 (56.19%), Query Frame = 0
BLAST of Cla97C05G100920 vs. TAIR10
Match: AT4G31950.1 (cytochrome P450, family 82, subfamily C, polypeptide 3) HSP 1 Score: 70.1 bits (170), Expect = 1.0e-12 Identity = 34/113 (30.09%), Postives = 62/113 (54.87%), Query Frame = 0
BLAST of Cla97C05G100920 vs. TAIR10
Match: AT4G37310.1 (cytochrome P450, family 81, subfamily H, polypeptide 1) HSP 1 Score: 63.2 bits (152), Expect = 1.3e-10 Identity = 35/116 (30.17%), Postives = 64/116 (55.17%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |