Cla97C05G098660 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCAGGCGTTTGGGTTTTTCGATCCAACGGCGTGATGCGCCTCGTTGAAAACTCTCAAGCCGGCGACGATTACTCCTCCGACGGTCACCACCATACCGCCGGTGGCGGAAGAAAGAAGGTTCTAGTTCATCTTCCTTCAGGGCAACCGGTTTCTTCCTACGGATTTCTTCAAAAGATTCTAGAAGGTCTGGGATGGGAACGATATTACGAAGGCGATCCAGATTTCTTCCAATTTCACAAGCGATCTTCTATTGATCTCATTTCCCTTCCAATGGACTTCTCCAAATTCAATTCCATTTATATGTACGATCTCGTCATCAAAAACCCTAACGTCTTTCACGTTCGAGAACCCTAA ATGTCAGGCGTTTGGGTTTTTCGATCCAACGGCGTGATGCGCCTCGTTGAAAACTCTCAAGCCGGCGACGATTACTCCTCCGACGGTCACCACCATACCGCCGGTGGCGGAAGAAAGAAGGTTCTAGTTCATCTTCCTTCAGGGCAACCGGTTTCTTCCTACGGATTTCTTCAAAAGATTCTAGAAGGTCTGGGATGGGAACGATATTACGAAGGCGATCCAGATTTCTTCCAATTTCACAAGCGATCTTCTATTGATCTCATTTCCCTTCCAATGGACTTCTCCAAATTCAATTCCATTTATATGTACGATCTCGTCATCAAAAACCCTAACGTCTTTCACGTTCGAGAACCCTAA ATGTCAGGCGTTTGGGTTTTTCGATCCAACGGCGTGATGCGCCTCGTTGAAAACTCTCAAGCCGGCGACGATTACTCCTCCGACGGTCACCACCATACCGCCGGTGGCGGAAGAAAGAAGGTTCTAGTTCATCTTCCTTCAGGGCAACCGGTTTCTTCCTACGGATTTCTTCAAAAGATTCTAGAAGGTCTGGGATGGGAACGATATTACGAAGGCGATCCAGATTTCTTCCAATTTCACAAGCGATCTTCTATTGATCTCATTTCCCTTCCAATGGACTTCTCCAAATTCAATTCCATTTATATGTACGATCTCGTCATCAAAAACCCTAACGTCTTTCACGTTCGAGAACCCTAA MSGVWVFRSNGVMRLVENSQAGDDYSSDGHHHTAGGGRKKVLVHLPSGQPVSSYGFLQKILEGLGWERYYEGDPDFFQFHKRSSIDLISLPMDFSKFNSIYMYDLVIKNPNVFHVREP
BLAST of Cla97C05G098660 vs. NCBI nr
Match: XP_022976219.1 (flowering-promoting factor 1-like protein 2 [Cucurbita maxima]) HSP 1 Score: 196.4 bits (498), Expect = 5.3e-47 Identity = 113/119 (94.96%), Postives = 116/119 (97.48%), Query Frame = 0
BLAST of Cla97C05G098660 vs. NCBI nr
Match: XP_004136318.1 (PREDICTED: flowering-promoting factor 1-like protein 2 [Cucumis sativus] >KGN60157.1 hypothetical protein Csa_3G881700 [Cucumis sativus]) HSP 1 Score: 196.1 bits (497), Expect = 6.9e-47 Identity = 114/123 (92.68%), Postives = 115/123 (93.50%), Query Frame = 0
BLAST of Cla97C05G098660 vs. NCBI nr
Match: XP_022940479.1 (flowering-promoting factor 1-like protein 2 [Cucurbita moschata]) HSP 1 Score: 194.5 bits (493), Expect = 2.0e-46 Identity = 97/118 (82.20%), Postives = 101/118 (85.59%), Query Frame = 0
BLAST of Cla97C05G098660 vs. NCBI nr
Match: XP_022937028.1 (flowering-promoting factor 1-like protein 2 [Cucurbita moschata]) HSP 1 Score: 193.0 bits (489), Expect = 5.9e-46 Identity = 112/121 (92.56%), Postives = 115/121 (95.04%), Query Frame = 0
BLAST of Cla97C05G098660 vs. NCBI nr
Match: XP_023536365.1 (flowering-promoting factor 1-like protein 2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 192.6 bits (488), Expect = 7.7e-46 Identity = 112/122 (91.80%), Postives = 115/122 (94.26%), Query Frame = 0
BLAST of Cla97C05G098660 vs. TrEMBL
Match: tr|A0A0A0LHE6|A0A0A0LHE6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G881700 PE=4 SV=1) HSP 1 Score: 196.1 bits (497), Expect = 4.6e-47 Identity = 114/123 (92.68%), Postives = 115/123 (93.50%), Query Frame = 0
BLAST of Cla97C05G098660 vs. TrEMBL
Match: tr|A0A1S3CSB1|A0A1S3CSB1_CUCME (flowering-promoting factor 1-like protein 2 OS=Cucumis melo OX=3656 GN=LOC103503767 PE=4 SV=1) HSP 1 Score: 192.2 bits (487), Expect = 6.6e-46 Identity = 114/129 (88.37%), Postives = 115/129 (89.15%), Query Frame = 0
BLAST of Cla97C05G098660 vs. TrEMBL
Match: tr|A0A068TXC9|A0A068TXC9_COFCA (Uncharacterized protein OS=Coffea canephora OX=49390 GN=GSCOC_T00034354001 PE=4 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 5.6e-37 Identity = 77/119 (64.71%), Postives = 91/119 (76.47%), Query Frame = 0
BLAST of Cla97C05G098660 vs. TrEMBL
Match: tr|W9RUY1|W9RUY1_9ROSA (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_004425 PE=4 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 7.3e-37 Identity = 79/117 (67.52%), Postives = 88/117 (75.21%), Query Frame = 0
BLAST of Cla97C05G098660 vs. TrEMBL
Match: tr|A0A1S3UE25|A0A1S3UE25_VIGRR (flowering-promoting factor 1-like protein 2 OS=Vigna radiata var. radiata OX=3916 GN=LOC106764531 PE=4 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 1.3e-36 Identity = 79/117 (67.52%), Postives = 89/117 (76.07%), Query Frame = 0
BLAST of Cla97C05G098660 vs. Swiss-Prot
Match: sp|Q5Q0B3|FLP1_ARATH (Flowering-promoting factor 1-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FLP1 PE=2 SV=2) HSP 1 Score: 144.4 bits (363), Expect = 7.8e-34 Identity = 92/123 (74.80%), Postives = 100/123 (81.30%), Query Frame = 0
BLAST of Cla97C05G098660 vs. Swiss-Prot
Match: sp|Q9LXB5|FLP2_ARATH (Flowering-promoting factor 1-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FLP2 PE=2 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 5.1e-33 Identity = 72/118 (61.02%), Postives = 87/118 (73.73%), Query Frame = 0
BLAST of Cla97C05G098660 vs. Swiss-Prot
Match: sp|O23624|FPF1_ARATH (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=2 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 9.6e-32 Identity = 71/119 (59.66%), Postives = 88/119 (73.95%), Query Frame = 0
BLAST of Cla97C05G098660 vs. Swiss-Prot
Match: sp|O24340|FPF1_SINAL (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 1.4e-30 Identity = 69/119 (57.98%), Postives = 87/119 (73.11%), Query Frame = 0
BLAST of Cla97C05G098660 vs. Swiss-Prot
Match: sp|Q9LGE3|FLP1_ORYSJ (Flowering-promoting factor 1-like protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=RAA1 PE=1 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.6e-26 Identity = 65/115 (56.52%), Postives = 75/115 (65.22%), Query Frame = 0
BLAST of Cla97C05G098660 vs. TAIR10
Match: AT4G31380.1 (FPF1-like protein 1) HSP 1 Score: 144.4 bits (363), Expect = 4.3e-35 Identity = 92/123 (74.80%), Postives = 100/123 (81.30%), Query Frame = 0
BLAST of Cla97C05G098660 vs. TAIR10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1)) HSP 1 Score: 141.7 bits (356), Expect = 2.8e-34 Identity = 72/118 (61.02%), Postives = 87/118 (73.73%), Query Frame = 0
BLAST of Cla97C05G098660 vs. TAIR10
Match: AT5G24860.1 (flowering promoting factor 1) HSP 1 Score: 137.5 bits (345), Expect = 5.3e-33 Identity = 71/119 (59.66%), Postives = 88/119 (73.95%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|