Cla97C05G092020 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGCTATGAATCCGAAGCCTTTTGTTGAGGGAGAAGCTGGTTCATATTACAAATGGTTGCCTTCTGACTATCCCTTGCTTGCTCAGACAAAGGTCGCCGCCGGCCGCCTTCTCCTCCGCCCTCGCGGCTTCGCCCTTCCTCACTATGCTGATTGCTCTAAATTCGGCTATGTTCTTCAAGGTAACCTCTCTGCAACTCTCTATTTTCTCGTTGATATCATTTTATAA ATGGAGGCTATGAATCCGAAGCCTTTTGTTGAGGGAGAAGCTGGTTCATATTACAAATGGTTGCCTTCTGACTATCCCTTGCTTGCTCAGACAAAGGTCGCCGCCGGCCGCCTTCTCCTCCGCCCTCGCGGCTTCGCCCTTCCTCACTATGCTGATTGCTCTAAATTCGGCTATGTTCTTCAAGGTAACCTCTCTGCAACTCTCTATTTTCTCGTTGATATCATTTTATAA ATGGAGGCTATGAATCCGAAGCCTTTTGTTGAGGGAGAAGCTGGTTCATATTACAAATGGTTGCCTTCTGACTATCCCTTGCTTGCTCAGACAAAGGTCGCCGCCGGCCGCCTTCTCCTCCGCCCTCGCGGCTTCGCCCTTCCTCACTATGCTGATTGCTCTAAATTCGGCTATGTTCTTCAAGGTAACCTCTCTGCAACTCTCTATTTTCTCGTTGATATCATTTTATAA MEAMNPKPFVEGEAGSYYKWLPSDYPLLAQTKVAAGRLLLRPRGFALPHYADCSKFGYVLQGNLSATLYFLVDIIL
BLAST of Cla97C05G092020 vs. NCBI nr
Match: XP_004151504.1 (PREDICTED: legumin J [Cucumis sativus] >KGN57580.1 hypothetical protein Csa_3G218160 [Cucumis sativus]) HSP 1 Score: 125.9 bits (315), Expect = 5.7e-26 Identity = 56/67 (83.58%), Postives = 59/67 (88.06%), Query Frame = 0
BLAST of Cla97C05G092020 vs. NCBI nr
Match: XP_008456076.1 (PREDICTED: glutelin type-A 2-like [Cucumis melo]) HSP 1 Score: 125.9 bits (315), Expect = 5.7e-26 Identity = 57/67 (85.07%), Postives = 58/67 (86.57%), Query Frame = 0
BLAST of Cla97C05G092020 vs. NCBI nr
Match: XP_022922755.1 (legumin J-like [Cucurbita moschata]) HSP 1 Score: 115.2 bits (287), Expect = 1.0e-22 Identity = 51/61 (83.61%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of Cla97C05G092020 vs. NCBI nr
Match: XP_023552908.1 (12S seed storage globulin 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 113.6 bits (283), Expect = 2.9e-22 Identity = 50/61 (81.97%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of Cla97C05G092020 vs. NCBI nr
Match: XP_022985328.1 (12S seed storage protein CRD-like [Cucurbita maxima]) HSP 1 Score: 113.2 bits (282), Expect = 3.8e-22 Identity = 50/61 (81.97%), Postives = 54/61 (88.52%), Query Frame = 0
BLAST of Cla97C05G092020 vs. TrEMBL
Match: tr|A0A1S3C2D5|A0A1S3C2D5_CUCME (glutelin type-A 2-like OS=Cucumis melo OX=3656 GN=LOC103496119 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.8e-26 Identity = 57/67 (85.07%), Postives = 58/67 (86.57%), Query Frame = 0
BLAST of Cla97C05G092020 vs. TrEMBL
Match: tr|A0A0A0L6K0|A0A0A0L6K0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G218160 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.8e-26 Identity = 56/67 (83.58%), Postives = 59/67 (88.06%), Query Frame = 0
BLAST of Cla97C05G092020 vs. TrEMBL
Match: tr|A0A0A0KA23|A0A0A0KA23_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G368140 PE=4 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 1.7e-18 Identity = 45/67 (67.16%), Postives = 52/67 (77.61%), Query Frame = 0
BLAST of Cla97C05G092020 vs. TrEMBL
Match: tr|A0A0A0K550|A0A0A0K550_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G337100 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 1.1e-17 Identity = 44/67 (65.67%), Postives = 51/67 (76.12%), Query Frame = 0
BLAST of Cla97C05G092020 vs. TrEMBL
Match: tr|A0A061E708|A0A061E708_THECC (RmlC-like cupins superfamily protein OS=Theobroma cacao OX=3641 GN=TCM_006913 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 4.2e-17 Identity = 41/68 (60.29%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of Cla97C05G092020 vs. TAIR10
Match: AT1G07750.1 (RmlC-like cupins superfamily protein) HSP 1 Score: 64.3 bits (155), Expect = 3.7e-11 Identity = 28/61 (45.90%), Postives = 37/61 (60.66%), Query Frame = 0
BLAST of Cla97C05G092020 vs. TAIR10
Match: AT2G28680.1 (RmlC-like cupins superfamily protein) HSP 1 Score: 59.3 bits (142), Expect = 1.2e-09 Identity = 25/57 (43.86%), Postives = 32/57 (56.14%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|