Cla97C05G085560 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACAGCCAAGTGCAAAGGCACAATAATGATCAATCCAAGTGTTTATAAATATATATATATATATATATATATATATATTTATTCTTTATTAGACTTTATAAAGTTTTTTTGCAATAAATTAAGCAATGTTGTTAATTTTGGTTGACTATCATTTAGGAAAGAGTTCATGGCCTGAGTTAGTGGGTAAGCTGGAAAAAGATGCTGAAAAGATCATAGAGAAAGAGAACCCTTTGGTTGATGCTATCATTGTTGATGAAGGTTCAATTGTCTCTTTTGACTTCAGGTGTGATAGGGTTTGGGTCTGGGTTTGTCAGAAAACCAACATCGTTACTAGGACTCCTTTTATTGGTTAG ATGACAGCCAAGTGCAAAGGCACAATAATGATCAATCCAAGAAAGAGTTCATGGCCTGAGTTAGTGGGTAAGCTGGAAAAAGATGCTGAAAAGATCATAGAGAAAGAGAACCCTTTGGTTGATGCTATCATTGTTGATGAAGGTTCAATTGTCTCTTTTGACTTCAGGTGTGATAGGGTTTGGGTCTGGGTTTGTCAGAAAACCAACATCGTTACTAGGACTCCTTTTATTGGTTAG ATGACAGCCAAGTGCAAAGGCACAATAATGATCAATCCAAGAAAGAGTTCATGGCCTGAGTTAGTGGGTAAGCTGGAAAAAGATGCTGAAAAGATCATAGAGAAAGAGAACCCTTTGGTTGATGCTATCATTGTTGATGAAGGTTCAATTGTCTCTTTTGACTTCAGGTGTGATAGGGTTTGGGTCTGGGTTTGTCAGAAAACCAACATCGTTACTAGGACTCCTTTTATTGGTTAG MTAKCKGTIMINPRKSSWPELVGKLEKDAEKIIEKENPLVDAIIVDEGSIVSFDFRCDRVWVWVCQKTNIVTRTPFIG
BLAST of Cla97C05G085560 vs. NCBI nr
Match: XP_004134090.1 (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus] >KGN56904.1 hypothetical protein Csa_3G142960 [Cucumis sativus]) HSP 1 Score: 117.1 bits (292), Expect = 2.7e-23 Identity = 57/78 (73.08%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of Cla97C05G085560 vs. NCBI nr
Match: KGN56905.1 (hypothetical protein Csa_3G142970 [Cucumis sativus]) HSP 1 Score: 91.7 bits (226), Expect = 1.2e-15 Identity = 47/78 (60.26%), Postives = 55/78 (70.51%), Query Frame = 0
BLAST of Cla97C05G085560 vs. NCBI nr
Match: XP_016898985.1 (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis melo]) HSP 1 Score: 91.3 bits (225), Expect = 1.6e-15 Identity = 47/78 (60.26%), Postives = 54/78 (69.23%), Query Frame = 0
BLAST of Cla97C05G085560 vs. NCBI nr
Match: POE98891.1 (glu s.griseus protease inhibitor [Quercus suber]) HSP 1 Score: 91.3 bits (225), Expect = 1.6e-15 Identity = 47/78 (60.26%), Postives = 54/78 (69.23%), Query Frame = 0
BLAST of Cla97C05G085560 vs. NCBI nr
Match: XP_003590795.1 (glu S.griseus protease inhibitor [Medicago truncatula] >AES61046.1 inhibitor of trypsin and hageman factor-like protein [Medicago truncatula] >AFK42591.1 unknown [Medicago truncatula] >KEH42752.1 inhibitor of trypsin and hageman factor-like protein [Medicago truncatula]) HSP 1 Score: 88.6 bits (218), Expect = 1.0e-14 Identity = 47/78 (60.26%), Postives = 54/78 (69.23%), Query Frame = 0
BLAST of Cla97C05G085560 vs. TrEMBL
Match: tr|A0A0A0L795|A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.8e-23 Identity = 57/78 (73.08%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of Cla97C05G085560 vs. TrEMBL
Match: tr|A0A0A0L4J0|A0A0A0L4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142970 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 8.1e-16 Identity = 47/78 (60.26%), Postives = 55/78 (70.51%), Query Frame = 0
BLAST of Cla97C05G085560 vs. TrEMBL
Match: tr|A0A1S4DTF7|A0A1S4DTF7_CUCME (inhibitor of trypsin and hageman factor-like OS=Cucumis melo OX=3656 GN=LOC103483638 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 1.1e-15 Identity = 47/78 (60.26%), Postives = 54/78 (69.23%), Query Frame = 0
BLAST of Cla97C05G085560 vs. TrEMBL
Match: tr|A0A2P4L0Z7|A0A2P4L0Z7_QUESU (Glu s.griseus protease inhibitor OS=Quercus suber OX=58331 GN=CFP56_44653 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 1.1e-15 Identity = 47/78 (60.26%), Postives = 54/78 (69.23%), Query Frame = 0
BLAST of Cla97C05G085560 vs. TrEMBL
Match: tr|G7I3Z2|G7I3Z2_MEDTR (Inhibitor of trypsin and hageman factor-like protein OS=Medicago truncatula OX=3880 GN=11425623 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 6.8e-15 Identity = 47/78 (60.26%), Postives = 54/78 (69.23%), Query Frame = 0
BLAST of Cla97C05G085560 vs. Swiss-Prot
Match: sp|P24076|BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.2e-11 Identity = 36/64 (56.25%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of Cla97C05G085560 vs. Swiss-Prot
Match: sp|P19873|ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.4e-10 Identity = 34/66 (51.52%), Postives = 45/66 (68.18%), Query Frame = 0
BLAST of Cla97C05G085560 vs. Swiss-Prot
Match: sp|P80211|ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.1e-10 Identity = 34/63 (53.97%), Postives = 40/63 (63.49%), Query Frame = 0
BLAST of Cla97C05G085560 vs. Swiss-Prot
Match: sp|P82381|ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 5.2e-10 Identity = 32/65 (49.23%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of Cla97C05G085560 vs. Swiss-Prot
Match: sp|P86971|ITI_FAGTA (Trypsin inhibitor OS=Fagopyrum tataricum OX=62330 PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.4e-07 Identity = 30/68 (44.12%), Postives = 40/68 (58.82%), Query Frame = 0
BLAST of Cla97C05G085560 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 68.9 bits (167), Expect = 1.5e-12 Identity = 33/71 (46.48%), Postives = 49/71 (69.01%), Query Frame = 0
BLAST of Cla97C05G085560 vs. TAIR10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 65.1 bits (157), Expect = 2.2e-11 Identity = 34/66 (51.52%), Postives = 44/66 (66.67%), Query Frame = 0
BLAST of Cla97C05G085560 vs. TAIR10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 45.1 bits (105), Expect = 2.4e-05 Identity = 27/65 (41.54%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of Cla97C05G085560 vs. TAIR10
Match: AT5G43570.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 44.3 bits (103), Expect = 4.0e-05 Identity = 25/61 (40.98%), Postives = 33/61 (54.10%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |