Cla97C05G085180 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACGAGAGTGGTGGGCGTGGAAGAAGTTATGCGGAGGATTCAACCACAGCCGGAGGCAGCAGAGAGATCCGTTACCGGGGAGTACGGCGGCGGCCATGGGGCAAATTCGCAGCTGAGATACGCGACTCTAGGAGGCAAGGAGTCCGCATATGGCTGGGCACATTCAACACGGCTGAAGAGGCCGCACGTGCTTACGATCGAGCGGCTTACAACATGAGGGGTCATTTGGCCATTTTGAACTTTCCCAATGAGTATCCACTCACAAGCTCCGGCGGCGGCGGTGGTGCTTATTCGAGTGGGTCGTCTTCATCTTCTTCTTCAATGTCAATGCGGCAAAATGAAGTGATTGAATTTGAGTATTTGGATGATAAAGTGCTTGAAGATCTTCTTGACTATGGAGAAGAAAGTGATAAGAGAAGCTAA ATGGACGAGAGTGGTGGGCGTGGAAGAAGTTATGCGGAGGATTCAACCACAGCCGGAGGCAGCAGAGAGATCCGTTACCGGGGAGTACGGCGGCGGCCATGGGGCAAATTCGCAGCTGAGATACGCGACTCTAGGAGGCAAGGAGTCCGCATATGGCTGGGCACATTCAACACGGCTGAAGAGGCCGCACGTGCTTACGATCGAGCGGCTTACAACATGAGGGGTCATTTGGCCATTTTGAACTTTCCCAATGAGTATCCACTCACAAGCTCCGGCGGCGGCGGTGGTGCTTATTCGAGTGGGTCGTCTTCATCTTCTTCTTCAATGTCAATGCGGCAAAATGAAGTGATTGAATTTGAGTATTTGGATGATAAAGTGCTTGAAGATCTTCTTGACTATGGAGAAGAAAGTGATAAGAGAAGCTAA ATGGACGAGAGTGGTGGGCGTGGAAGAAGTTATGCGGAGGATTCAACCACAGCCGGAGGCAGCAGAGAGATCCGTTACCGGGGAGTACGGCGGCGGCCATGGGGCAAATTCGCAGCTGAGATACGCGACTCTAGGAGGCAAGGAGTCCGCATATGGCTGGGCACATTCAACACGGCTGAAGAGGCCGCACGTGCTTACGATCGAGCGGCTTACAACATGAGGGGTCATTTGGCCATTTTGAACTTTCCCAATGAGTATCCACTCACAAGCTCCGGCGGCGGCGGTGGTGCTTATTCGAGTGGGTCGTCTTCATCTTCTTCTTCAATGTCAATGCGGCAAAATGAAGTGATTGAATTTGAGTATTTGGATGATAAAGTGCTTGAAGATCTTCTTGACTATGGAGAAGAAAGTGATAAGAGAAGCTAA MDESGGRGRSYAEDSTTAGGSREIRYRGVRRRPWGKFAAEIRDSRRQGVRIWLGTFNTAEEAARAYDRAAYNMRGHLAILNFPNEYPLTSSGGGGGAYSSGSSSSSSSMSMRQNEVIEFEYLDDKVLEDLLDYGEESDKRS
BLAST of Cla97C05G085180 vs. NCBI nr
Match: XP_022980085.1 (ethylene-responsive transcription factor ERF096 [Cucurbita maxima]) HSP 1 Score: 211.1 bits (536), Expect = 2.5e-51 Identity = 121/141 (85.82%), Postives = 126/141 (89.36%), Query Frame = 0
BLAST of Cla97C05G085180 vs. NCBI nr
Match: XP_023529041.1 (ethylene-responsive transcription factor ERF096-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 209.9 bits (533), Expect = 5.5e-51 Identity = 126/141 (89.36%), Postives = 132/141 (93.62%), Query Frame = 0
BLAST of Cla97C05G085180 vs. NCBI nr
Match: XP_004134413.1 (PREDICTED: ethylene-responsive transcription factor 14 [Cucumis sativus] >KGN56866.1 hypothetical protein Csa_3G135630 [Cucumis sativus]) HSP 1 Score: 209.5 bits (532), Expect = 7.2e-51 Identity = 121/141 (85.82%), Postives = 122/141 (86.52%), Query Frame = 0
BLAST of Cla97C05G085180 vs. NCBI nr
Match: XP_022924727.1 (ethylene-responsive transcription factor ERF096-like [Cucurbita moschata]) HSP 1 Score: 207.6 bits (527), Expect = 2.8e-50 Identity = 125/141 (88.65%), Postives = 131/141 (92.91%), Query Frame = 0
BLAST of Cla97C05G085180 vs. NCBI nr
Match: XP_008438537.1 (PREDICTED: ethylene-responsive transcription factor ERF096 [Cucumis melo]) HSP 1 Score: 204.5 bits (519), Expect = 2.3e-49 Identity = 130/141 (92.20%), Postives = 132/141 (93.62%), Query Frame = 0
BLAST of Cla97C05G085180 vs. TrEMBL
Match: tr|A0A0A0L9V5|A0A0A0L9V5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G135630 PE=4 SV=1) HSP 1 Score: 209.5 bits (532), Expect = 4.8e-51 Identity = 121/141 (85.82%), Postives = 122/141 (86.52%), Query Frame = 0
BLAST of Cla97C05G085180 vs. TrEMBL
Match: tr|A0A1S3AW98|A0A1S3AW98_CUCME (ethylene-responsive transcription factor ERF096 OS=Cucumis melo OX=3656 GN=LOC103483602 PE=4 SV=1) HSP 1 Score: 204.5 bits (519), Expect = 1.5e-49 Identity = 130/141 (92.20%), Postives = 132/141 (93.62%), Query Frame = 0
BLAST of Cla97C05G085180 vs. TrEMBL
Match: tr|K4CW17|K4CW17_SOLLC (Uncharacterized protein OS=Solanum lycopersicum OX=4081 PE=4 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 1.5e-33 Identity = 102/131 (77.86%), Postives = 112/131 (85.50%), Query Frame = 0
BLAST of Cla97C05G085180 vs. TrEMBL
Match: tr|A0A200PW61|A0A200PW61_9MAGN (AP2/ERF domain OS=Macleaya cordata OX=56857 GN=BVC80_9099g238 PE=4 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 2.0e-33 Identity = 98/140 (70.00%), Postives = 113/140 (80.71%), Query Frame = 0
BLAST of Cla97C05G085180 vs. TrEMBL
Match: tr|A0A2U1LT58|A0A2U1LT58_ARTAN (DNA-binding domain-containing protein OS=Artemisia annua OX=35608 GN=CTI12_AA458830 PE=4 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 3.5e-33 Identity = 78/141 (55.32%), Postives = 92/141 (65.25%), Query Frame = 0
BLAST of Cla97C05G085180 vs. Swiss-Prot
Match: sp|Q9LTC6|ERF95_ARATH (Ethylene-responsive transcription factor ERF095 OS=Arabidopsis thaliana OX=3702 GN=ERF095 PE=1 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 7.4e-31 Identity = 84/123 (68.29%), Postives = 98/123 (79.67%), Query Frame = 0
BLAST of Cla97C05G085180 vs. Swiss-Prot
Match: sp|P93822|ERF97_ARATH (Ethylene-responsive transcription factor 14 OS=Arabidopsis thaliana OX=3702 GN=ERF14 PE=2 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 1.1e-29 Identity = 81/137 (59.12%), Postives = 98/137 (71.53%), Query Frame = 0
BLAST of Cla97C05G085180 vs. Swiss-Prot
Match: sp|Q9LTC5|ERF98_ARATH (Ethylene-responsive transcription factor ERF098 OS=Arabidopsis thaliana OX=3702 GN=ERF098 PE=1 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 2.2e-27 Identity = 85/121 (70.25%), Postives = 92/121 (76.03%), Query Frame = 0
BLAST of Cla97C05G085180 vs. Swiss-Prot
Match: sp|Q9LSX0|ERF96_ARATH (Ethylene-responsive transcription factor ERF096 OS=Arabidopsis thaliana OX=3702 GN=ERF096 PE=1 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.7e-25 Identity = 89/137 (64.96%), Postives = 104/137 (75.91%), Query Frame = 0
BLAST of Cla97C05G085180 vs. Swiss-Prot
Match: sp|O04681|PTI5_SOLLC (Pathogenesis-related genes transcriptional activator PTI5 OS=Solanum lycopersicum OX=4081 GN=PTI5 PE=2 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.4e-21 Identity = 47/61 (77.05%), Postives = 53/61 (86.89%), Query Frame = 0
BLAST of Cla97C05G085180 vs. TAIR10
Match: AT3G23220.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 134.8 bits (338), Expect = 4.1e-32 Identity = 84/123 (68.29%), Postives = 98/123 (79.67%), Query Frame = 0
BLAST of Cla97C05G085180 vs. TAIR10
Match: AT1G04370.1 (Ethylene-responsive element binding factor 14) HSP 1 Score: 131.0 bits (328), Expect = 5.9e-31 Identity = 81/137 (59.12%), Postives = 98/137 (71.53%), Query Frame = 0
BLAST of Cla97C05G085180 vs. TAIR10
Match: AT3G23230.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 123.2 bits (308), Expect = 1.2e-28 Identity = 85/121 (70.25%), Postives = 92/121 (76.03%), Query Frame = 0
BLAST of Cla97C05G085180 vs. TAIR10
Match: AT5G43410.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 115.5 bits (288), Expect = 2.6e-26 Identity = 89/137 (64.96%), Postives = 104/137 (75.91%), Query Frame = 0
BLAST of Cla97C05G085180 vs. TAIR10
Match: AT1G06160.1 (octadecanoid-responsive Arabidopsis AP2/ERF 59) HSP 1 Score: 101.7 bits (252), Expect = 3.9e-22 Identity = 46/71 (64.79%), Postives = 59/71 (83.10%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |