Cla97C05G083730 (gene) Watermelon (97103) v2

Overview
NameCla97C05G083730
Typegene
OrganismCitrullus lanatus (Watermelon (97103) v2)
DescriptionUnknown protein
LocationCla97Chr05 : 2837166 .. 2837790 (-)
Genome Viewer
Sequences
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGAGGACGGTAGTTCGGGAGTTCGCTCGAAAGAACTGGCGTACCAAGGGGGATCTTTCGATCACTCTGTTAGATCCAAGGTATGTCTTCATCACGTTCTCAAACAAAGAAGATGAAGACATACCTTGGAGTTTATAGTTTAGGGTTTTCCGCTGGAGCCATGATTTCCGTCTCCGCAATGGTGATCCAATGCATGCGCCTATTTGGGTTTGGGTATCGCGACTCCATCCGCCTATTGTCTTCTTCTTTGAGTTTCGCCTGTTTTCTATCGTCTCGACTTTCGGAATTGGCCTGACCCTTGAAGGTCCTACGAAGCTTGTCTCACGCCCCCCTCTCACAATAAAGCTAGGGTTTGTGTAGAAATCGGTCTTCTCAAGGAAAACCTCCCAAATCGTGTTTTGATTGGATCGACTGTGTATGTATGGATCACTAGCAAGAAATCGTTTCTTTTTGAATACCTAAGTTCTGCACGCATTGCAGACGACAAGGTCATGCCCGTCACGAATGCAAAGTGGCGAATAAGGAACCTGGTGTCAACCCGTCACCGAGAATGGCCTATGTTCCAAGAACCAATGCTACCCAGCACCTACCACTGAAGTTAGCCTTCGTGATTCAGATGTTGTGA

mRNA sequence

ATGAGGACGGTAGTTCGGGAGTTCGCTCGAAAGAACTGGCGTACCAAGGGGGATCTTTCGATCACTCTGTTAGATCCAAGGGTTTTCCGCTGGAGCCATGATTTCCGTCTCCGCAATGGTGATCCAATGCATGCGCCTATTTGGGTTTGGGTATCGCGACTCCATCCGCCTATTGTCTTCTTCTTTGAGTTTCGCCTGTTTTCTATCGTCTCGACTTTCGGAATTGGCCTGACCCTTGAAGGTCCTACGAAGCTTGTCTCACGCCCCCCTCTCACAATAAAGCTAGGACGACAAGGTCATGCCCGTCACGAATGCAAAGTGGCGAATAAGGAACCTGGTGTCAACCCGTCACCGAGAATGGCCTATGTTCCAAGAACCAATGCTACCCAGCACCTACCACTGAAGTTAGCCTTCGTGATTCAGATGTTGTGA

Coding sequence (CDS)

ATGAGGACGGTAGTTCGGGAGTTCGCTCGAAAGAACTGGCGTACCAAGGGGGATCTTTCGATCACTCTGTTAGATCCAAGGGTTTTCCGCTGGAGCCATGATTTCCGTCTCCGCAATGGTGATCCAATGCATGCGCCTATTTGGGTTTGGGTATCGCGACTCCATCCGCCTATTGTCTTCTTCTTTGAGTTTCGCCTGTTTTCTATCGTCTCGACTTTCGGAATTGGCCTGACCCTTGAAGGTCCTACGAAGCTTGTCTCACGCCCCCCTCTCACAATAAAGCTAGGACGACAAGGTCATGCCCGTCACGAATGCAAAGTGGCGAATAAGGAACCTGGTGTCAACCCGTCACCGAGAATGGCCTATGTTCCAAGAACCAATGCTACCCAGCACCTACCACTGAAGTTAGCCTTCGTGATTCAGATGTTGTGA

Protein sequence

MRTVVREFARKNWRTKGDLSITLLDPRVFRWSHDFRLRNGDPMHAPIWVWVSRLHPPIVFFFEFRLFSIVSTFGIGLTLEGPTKLVSRPPLTIKLGRQGHARHECKVANKEPGVNPSPRMAYVPRTNATQHLPLKLAFVIQML
Homology
The following BLAST results are available for this feature:
BLAST of Cla97C05G083730 vs. NCBI nr
Match NameE-valueIdentityDescription
BLAST of Cla97C05G083730 vs. TrEMBL
Match NameE-valueIdentityDescription
BLAST of Cla97C05G083730 vs. Swiss-Prot
Match NameE-valueIdentityDescription
BLAST of Cla97C05G083730 vs. TAIR10
Match NameE-valueIdentityDescription
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007267 cell-cell signaling
biological_process GO:0009909 regulation of flower development
biological_process GO:0008150 biological_process
biological_process GO:0009616 virus induced gene silencing
biological_process GO:0010048 vernalization response
biological_process GO:0010228 vegetative to reproductive phase transition of meristem
biological_process GO:0016233 telomere capping
biological_process GO:0010182 sugar mediated signaling pathway
biological_process GO:0009845 seed germination
biological_process GO:0010162 seed dormancy process
biological_process GO:0050826 response to freezing
biological_process GO:0000911 cytokinesis by cell plate formation
biological_process GO:0007346 regulation of mitotic cell cycle
biological_process GO:0016567 protein ubiquitination
biological_process GO:0009933 meristem structural organization
biological_process GO:0006302 double-strand break repair
biological_process GO:0009793 embryo development ending in seed dormancy
biological_process GO:0009560 embryo sac egg cell differentiation
biological_process GO:0006606 protein import into nucleus
biological_process GO:0019915 lipid storage
biological_process GO:0000226 microtubule cytoskeleton organization
biological_process GO:0006312 mitotic recombination
biological_process GO:0009640 photomorphogenesis
biological_process GO:0035196 production of miRNAs involved in gene silencing by miRNA
biological_process GO:0010267 production of ta-siRNAs involved in RNA interference
cellular_component GO:0005737 cytoplasm
cellular_component GO:0030870 Mre11 complex
cellular_component GO:0005575 cellular_component
molecular_function GO:0016887 ATPase activity
molecular_function GO:0003674 molecular_function
Relationships

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Cla97C05G083730.1Cla97C05G083730.1mRNA


Synteny
The following gene(s) are orthologous to this gene:
GeneOrthologueOrganismBlock
Cla97C05G083730Cla021398Watermelon (97103) v1wmwmbB206
Cla97C05G083730ClCG05G003100Watermelon (Charleston Gray)wcgwmbB229
The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
Cla97C05G083730Watermelon (97103) v2wmbwmbB137
Cla97C05G083730Silver-seed gourdcarwmbB0229
Cla97C05G083730Silver-seed gourdcarwmbB1008
Cla97C05G083730Silver-seed gourdcarwmbB1131
Cla97C05G083730Cucumber (Gy14) v2cgybwmbB196
Cla97C05G083730Cucumber (Gy14) v1cgywmbB452
Cla97C05G083730Cucurbita maxima (Rimu)cmawmbB263
Cla97C05G083730Cucurbita maxima (Rimu)cmawmbB366
Cla97C05G083730Cucurbita maxima (Rimu)cmawmbB856
Cla97C05G083730Cucurbita moschata (Rifu)cmowmbB243
Cla97C05G083730Cucurbita moschata (Rifu)cmowmbB350
Cla97C05G083730Cucurbita moschata (Rifu)cmowmbB833
Cla97C05G083730Cucurbita moschata (Rifu)cmowmbB886
Cla97C05G083730Wild cucumber (PI 183967)cpiwmbB209
Cla97C05G083730Cucumber (Chinese Long) v3cucwmbB206
Cla97C05G083730Cucumber (Chinese Long) v2cuwmbB204
Cla97C05G083730Bottle gourd (USVL1VR-Ls)lsiwmbB015
Cla97C05G083730Bottle gourd (USVL1VR-Ls)lsiwmbB333
Cla97C05G083730Melon (DHL92) v3.6.1medwmbB423
Cla97C05G083730Melon (DHL92) v3.5.1mewmbB434
Cla97C05G083730Watermelon (Charleston Gray)wcgwmbB269
Cla97C05G083730Wax gourdwgowmbB180