Cla97C03G061580 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTACTCCAAGTGCTATGACTTTCCTACTTCACGCCAAGTGTTCGACGAAATGGCTACAAAAAGTGTCATCTCTTGGAATTCTATGATTGTCGCTTATTCTATGATCATCTCGACTTTTGTAAGCTTATTGTCAGGTTTTGCTAACCCAACTCATGGATATCTCTTGCAGGGGCTTTTGGTACATGGTTGCATTACCAAATTTCAACTTCATGATGACACGCCGGTGGCAAATTCTCTTATGCAAATGTATGTAAACTTTCGTCAAATTGATTCTGCTTGCTCTATTTTTTATGCCACTAGTGACAAGACAGTAATTTCTTGGACAATAATGCTTGGTCGTTACTTGAGCTGTATTTGGTTTGTTATCTAAAAAAGCATTAATTTCAAAAATGGTTTTAATATTGTTTACAGCTTCAGAATTGGATATTGAGTTGGTTTATCAACTAATTATTTGGGAGGGTACTGTGGAAGCTCACTTGATTGGTTCAATTTGTATGAAATCTCAATTTTATCCAATTATTTGTTGGAACATTCCAGGTGACATTTATTTATTTATTTATTTTTAAATAGGATTGCAAATCAATCTGTATTTTATGGTTTCAAATGATTTTCATTACAGGGAGATTTATGGGTGGTCCAGTTACTTGTGGTATGATACGAGGACTTGA ATGTACTCCAAGTGCTATGACTTTCCTACTTCACGCCAAGTGTTCGACGAAATGGCTACAAAAAGTGTCATCTCTTGGAATTCTATGATTGTCGCTTATTCTATGATCATCTCGACTTTTGTAAGCTTATTGTCAGGTTTTGCTAACCCAACTCATGGATATCTCTTGCAGGGGCTTTTGGTACATGGTTGCATTACCAAATTTCAACTTCATGATGACACGCCGGTGGCAAATTCTCTTATGCAAATGGAGATTTATGGGTGGTCCAGTTACTTGTGGTATGATACGAGGACTTGA ATGTACTCCAAGTGCTATGACTTTCCTACTTCACGCCAAGTGTTCGACGAAATGGCTACAAAAAGTGTCATCTCTTGGAATTCTATGATTGTCGCTTATTCTATGATCATCTCGACTTTTGTAAGCTTATTGTCAGGTTTTGCTAACCCAACTCATGGATATCTCTTGCAGGGGCTTTTGGTACATGGTTGCATTACCAAATTTCAACTTCATGATGACACGCCGGTGGCAAATTCTCTTATGCAAATGGAGATTTATGGGTGGTCCAGTTACTTGTGGTATGATACGAGGACTTGA MYSKCYDFPTSRQVFDEMATKSVISWNSMIVAYSMIISTFVSLLSGFANPTHGYLLQGLLVHGCITKFQLHDDTPVANSLMQMEIYGWSSYLWYDTRT
BLAST of Cla97C03G061580 vs. NCBI nr
Match: XP_022137264.1 (pentatricopeptide repeat-containing protein At2g13600-like [Momordica charantia]) HSP 1 Score: 117.1 bits (292), Expect = 3.4e-23 Identity = 61/106 (57.55%), Postives = 71/106 (66.98%), Query Frame = 0
BLAST of Cla97C03G061580 vs. NCBI nr
Match: XP_004137641.1 (PREDICTED: pentatricopeptide repeat-containing protein At3g12770 [Cucumis sativus] >KGN64229.1 hypothetical protein Csa_1G043310 [Cucumis sativus]) HSP 1 Score: 115.9 bits (289), Expect = 7.6e-23 Identity = 62/106 (58.49%), Postives = 70/106 (66.04%), Query Frame = 0
BLAST of Cla97C03G061580 vs. NCBI nr
Match: XP_008446053.1 (PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Cucumis melo]) HSP 1 Score: 109.0 bits (271), Expect = 9.3e-21 Identity = 60/106 (56.60%), Postives = 67/106 (63.21%), Query Frame = 0
BLAST of Cla97C03G061580 vs. NCBI nr
Match: XP_014495233.1 (pentatricopeptide repeat-containing protein At3g12770 [Vigna radiata var. radiata]) HSP 1 Score: 70.1 bits (170), Expect = 4.8e-09 Identity = 42/106 (39.62%), Postives = 60/106 (56.60%), Query Frame = 0
BLAST of Cla97C03G061580 vs. NCBI nr
Match: XP_017438900.1 (PREDICTED: pentatricopeptide repeat-containing protein At2g03380, mitochondrial-like [Vigna angularis] >KOM54631.1 hypothetical protein LR48_Vigan10g052300 [Vigna angularis] >BAU02540.1 hypothetical protein VIGAN_11208900 [Vigna angularis var. angularis]) HSP 1 Score: 68.9 bits (167), Expect = 1.1e-08 Identity = 41/106 (38.68%), Postives = 59/106 (55.66%), Query Frame = 0
BLAST of Cla97C03G061580 vs. TrEMBL
Match: tr|A0A0A0LT91|A0A0A0LT91_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G043310 PE=4 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 5.0e-23 Identity = 62/106 (58.49%), Postives = 70/106 (66.04%), Query Frame = 0
BLAST of Cla97C03G061580 vs. TrEMBL
Match: tr|A0A1S3BDP0|A0A1S3BDP0_CUCME (pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like OS=Cucumis melo OX=3656 GN=LOC103488899 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 6.1e-21 Identity = 60/106 (56.60%), Postives = 67/106 (63.21%), Query Frame = 0
BLAST of Cla97C03G061580 vs. TrEMBL
Match: tr|A0A1S3TN93|A0A1S3TN93_VIGRR (pentatricopeptide repeat-containing protein At3g12770-like OS=Vigna radiata var. radiata OX=3916 GN=LOC106757146 PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 3.2e-09 Identity = 42/106 (39.62%), Postives = 60/106 (56.60%), Query Frame = 0
BLAST of Cla97C03G061580 vs. TrEMBL
Match: tr|A0A0L9VHU5|A0A0L9VHU5_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan10g052300 PE=4 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 7.0e-09 Identity = 41/106 (38.68%), Postives = 59/106 (55.66%), Query Frame = 0
BLAST of Cla97C03G061580 vs. TrEMBL
Match: tr|A0A0S3TBU1|A0A0S3TBU1_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis OX=157739 GN=Vigan.11G208900 PE=4 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 7.0e-09 Identity = 41/106 (38.68%), Postives = 59/106 (55.66%), Query Frame = 0
BLAST of Cla97C03G061580 vs. Swiss-Prot
Match: sp|O49619|PP350_ARATH (Pentatricopeptide repeat-containing protein At4g35130, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-H27 PE=3 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.1e-04 Identity = 32/104 (30.77%), Postives = 49/104 (47.12%), Query Frame = 0
BLAST of Cla97C03G061580 vs. Swiss-Prot
Match: sp|Q3E6Q1|PPR32_ARATH (Pentatricopeptide repeat-containing protein At1g11290, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-H40 PE=2 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 7.0e-04 Identity = 19/33 (57.58%), Postives = 25/33 (75.76%), Query Frame = 0
BLAST of Cla97C03G061580 vs. Swiss-Prot
Match: sp|B8YEK4|OGR1_ORYSJ (Pentatricopeptide repeat-containing protein OGR1, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=OGR1 PE=2 SV=1) HSP 1 Score: 44.3 bits (103), Expect = 9.2e-04 Identity = 30/107 (28.04%), Postives = 47/107 (43.93%), Query Frame = 0
BLAST of Cla97C03G061580 vs. Swiss-Prot
Match: sp|Q9C9H9|PP114_ARATH (Pentatricopeptide repeat-containing protein At1g71420 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H70 PE=2 SV=1) HSP 1 Score: 44.3 bits (103), Expect = 9.2e-04 Identity = 30/97 (30.93%), Postives = 45/97 (46.39%), Query Frame = 0
BLAST of Cla97C03G061580 vs. TAIR10
Match: AT4G35130.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 47.4 bits (111), Expect = 6.0e-06 Identity = 32/104 (30.77%), Postives = 49/104 (47.12%), Query Frame = 0
BLAST of Cla97C03G061580 vs. TAIR10
Match: AT1G11290.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 44.7 bits (104), Expect = 3.9e-05 Identity = 19/33 (57.58%), Postives = 25/33 (75.76%), Query Frame = 0
BLAST of Cla97C03G061580 vs. TAIR10
Match: AT1G71420.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 44.3 bits (103), Expect = 5.1e-05 Identity = 30/97 (30.93%), Postives = 45/97 (46.39%), Query Frame = 0
BLAST of Cla97C03G061580 vs. TAIR10
Match: AT3G47840.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 43.9 bits (102), Expect = 6.6e-05 Identity = 27/102 (26.47%), Postives = 47/102 (46.08%), Query Frame = 0
BLAST of Cla97C03G061580 vs. TAIR10
Match: AT2G44880.1 (Pentatricopeptide repeat (PPR-like) superfamily protein) HSP 1 Score: 42.4 bits (98), Expect = 1.9e-04 Identity = 17/35 (48.57%), Postives = 25/35 (71.43%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|