Cla97C03G053910 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATGATTTTAGAGCAGCTATGAAAATTCTAATATGGCTTGGGATTTTCAAGAAATATTATGATTTTAGTAGGAACCATGGTTTTAGAACCATTTGAGATATTTTATTACTATTTGAGAATTTGAAATGTTTTACCATGTTGAGAAATGAAAATGATATTTTACAAGCTTGAAAAATTATTGAGCTTTGTGTGAAATCTTGTTTCAGAGAGAAAGAGCATGAACTAGAATAGTTGAGAATAAAGAGTTCTATGTTGGAAGTTGCTTTGGTTATTCTTTACCTTGGGACCAAATTGGTTATTGGGCAGTCAAAATTGTAACAGGTGTACCGGAAGCTATTCTAGTAATAGAGTCACCTTTGGTAGAGTTATTACGCGGAAGTGTTAGTGTGGGACAATCTACCTTGACTCATTTTTATAGTTTACACACTTTTGTATTACCTCTTCTTAGTGCCGTATTTATGTTAATGCACTTCCCAATGATACGAATTTCGTCTCGTACGGCTTAA ATGTATGATTTTAGAGCAGCTATGAAAATTCTAATATGGCTTGGGATTTTCAAGAAATATTATGATTTTAGTAGGAACCATGAGTTCTATGTTGGAAGTTGCTTTGGTTATTCTTTACCTTGGGACCAAATTGGTTATTGGGCAGTCAAAATTGTAACAGGTGTACCGGAAGCTATTCTAGTAATAGAGTCACCTTTGGTAGAGTTATTACGCGGAAGTGTTAGTGTGGGACAATCTACCTTGACTCATTTTTATAGTTTACACACTTTTGTATTACCTCTTCTTAGTGCCGTATTTATGTTAATGCACTTCCCAATGATACGAATTTCGTCTCGTACGGCTTAA ATGTATGATTTTAGAGCAGCTATGAAAATTCTAATATGGCTTGGGATTTTCAAGAAATATTATGATTTTAGTAGGAACCATGAGTTCTATGTTGGAAGTTGCTTTGGTTATTCTTTACCTTGGGACCAAATTGGTTATTGGGCAGTCAAAATTGTAACAGGTGTACCGGAAGCTATTCTAGTAATAGAGTCACCTTTGGTAGAGTTATTACGCGGAAGTGTTAGTGTGGGACAATCTACCTTGACTCATTTTTATAGTTTACACACTTTTGTATTACCTCTTCTTAGTGCCGTATTTATGTTAATGCACTTCCCAATGATACGAATTTCGTCTCGTACGGCTTAA MYDFRAAMKILIWLGIFKKYYDFSRNHEFYVGSCFGYSLPWDQIGYWAVKIVTGVPEAILVIESPLVELLRGSVSVGQSTLTHFYSLHTFVLPLLSAVFMLMHFPMIRISSRTA
BLAST of Cla97C03G053910 vs. NCBI nr
Match: AWI70333.1 (cytochrome b6 (chloroplast) [Plumeria cubensis]) HSP 1 Score: 135.6 bits (340), Expect = 1.1e-28 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. NCBI nr
Match: YP_665588.1 (cytochrome b6 [Populus alba] >YP_001109532.1 cytochrome b6 [Populus trichocarpa] >YP_009054165.1 cytochrome b6 (chloroplast) [Populus balsamifera] >YP_009054084.1 cytochrome b6 (chloroplast) [Populus fremontii] >YP_009154440.1 cytochrome b6 (chloroplast) [Populus tremula] >YP_009182679.1 cytochrome b6 (chloroplast) [Populus tremula x Populus alba] >YP_009307695.1 cytochrome b6 (chloroplast) [Populus qiongdaoensis] >YP_009331974.1 cytochrome b6 (chloroplast) [Populus adenopoda] >YP_009335981.1 cytochrome b6 (chloroplast) [Populus davidiana] >YP_009346716.1 cytochrome b6 (chloroplast) [Populus rotundifolia] >YP_009434053.1 cytochrome b6 (chloroplast) [Populus lasiocarpa] >Q14FC7.1 RecName: Full=Cytochrome b6 >BAE97235.1 cytochrome b6 (chloroplast) [Populus alba] >ABO36736.1 cytochrome b6 (chloroplast) [Populus trichocarpa] >AID60418.1 cytochrome b6 (chloroplast) [Populus fremontii] >AID60499.1 cytochrome b6 (chloroplast) [Populus balsamifera] >AJV86781.1 cytochrome b6 (chloroplast) [Populus tremula] >AKF33971.1 cytochrome b6 (chloroplast) [Populus yunnanensis] >ALH07361.1 cytochrome b6 (chloroplast) [Populus tremula x Populus alba] >AOR82529.1 cytochrome b6 (chloroplast) [Populus qiongdaoensis] >AOS86477.1 cytochrome b6 (chloroplast) [Populus lasiocarpa] >APH07592.1 cytochrome b6 (chloroplast) [Populus adenopoda] >APO09027.1 cytochrome b6 (chloroplast) [Populus nigra] >APO15416.1 cytochrome b6 (chloroplast) [Populus davidiana] >APR73124.1 cytochrome b6 (chloroplast) [Populus rotundifolia] >AVK41956.1 cytochrome b6 (chloroplast) [Populus wilsonii]) HSP 1 Score: 134.8 bits (338), Expect = 1.8e-28 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. NCBI nr
Match: YP_003097604.1 (cytochrome b6 (chloroplast) [Dendrocalamus latiflorus] >YP_009452138.1 cytochrome b6 (chloroplast) [Rhipidocladum pittieri] >ACT99948.1 cytochrome b6 (chloroplast) [Dendrocalamus latiflorus] >ARQ28453.1 cytochrome b6 (chloroplast) [Rhipidocladum pittieri]) HSP 1 Score: 134.8 bits (338), Expect = 1.8e-28 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. NCBI nr
Match: ACT67274.1 (cytochrome b6, partial (chloroplast) [Joinvillea plicata] >AEJ10355.1 cytochrome b6, partial (plastid) [Abolboda macrostachya] >AEJ10369.1 cytochrome b6, partial (plastid) [Eleusine coracana] >AEJ10370.1 cytochrome b6, partial (plastid) [Flagellaria indica] >AEJ10394.1 cytochrome b6, partial (plastid) [Streptochaeta angustifolia]) HSP 1 Score: 134.8 bits (338), Expect = 1.8e-28 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. NCBI nr
Match: ADN86073.1 (cytochrome b6, partial (chloroplast) [Chasmanthium latifolium]) HSP 1 Score: 134.8 bits (338), Expect = 1.8e-28 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. TrEMBL
Match: tr|A0A2S1U5Q8|A0A2S1U5Q8_9GENT (Cytochrome b6 OS=Plumeria cubensis OX=403113 GN=petB PE=4 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 7.1e-29 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. TrEMBL
Match: tr|A0A059P2R5|A0A059P2R5_9GENT (Cytochrome b6 OS=Asclepias coulteri OX=659948 GN=petB PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 1.2e-28 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. TrEMBL
Match: tr|A0A221HM94|A0A221HM94_9ERIC (Cytochrome b6 OS=Pyrenaria spectabilis var. greeniae OX=197092 GN=petB PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 1.2e-28 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. TrEMBL
Match: tr|A0A0C5CHX0|A0A0C5CHX0_ACTCH (Cytochrome b6 OS=Actinidia chinensis OX=3625 GN=petB PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 1.2e-28 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. TrEMBL
Match: tr|A0A0X8IHM5|A0A0X8IHM5_9GENT (Cytochrome b6 OS=Cynanchum auriculatum OX=157409 GN=petB PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 1.2e-28 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. Swiss-Prot
Match: sp|Q7YJU8|CYB6_CALFG (Cytochrome b6 OS=Calycanthus floridus var. glaucus OX=212734 GN=petB PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 6.0e-31 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. Swiss-Prot
Match: sp|Q14FC7|CYB6_POPAL (Cytochrome b6 OS=Populus alba OX=43335 GN=petB PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 6.0e-31 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. Swiss-Prot
Match: sp|Q6L372|CYB6_SACHY (Cytochrome b6 OS=Saccharum hybrid OX=15819 GN=petB PE=3 SV=2) HSP 1 Score: 134.8 bits (338), Expect = 6.0e-31 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. Swiss-Prot
Match: sp|Q6ENT4|CYB6_SACOF (Cytochrome b6 OS=Saccharum officinarum OX=4547 GN=petB PE=3 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 6.0e-31 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. Swiss-Prot
Match: sp|A1E9V4|CYB6_SORBI (Cytochrome b6 OS=Sorghum bicolor OX=4558 GN=petB PE=3 SV=2) HSP 1 Score: 134.8 bits (338), Expect = 6.0e-31 Identity = 68/73 (93.15%), Postives = 69/73 (94.52%), Query Frame = 0
BLAST of Cla97C03G053910 vs. TAIR10
Match: ATCG00720.1 (photosynthetic electron transfer B) HSP 1 Score: 129.8 bits (325), Expect = 1.1e-30 Identity = 66/73 (90.41%), Postives = 68/73 (93.15%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|