Cla97C03G053890 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTCATTATTTTCTTATCCTTCTCTCTCTCTTTTTGTTCTTCTCTTTCACCTCTTGCCAGAATCCTCCCTCCCCTGGCTATTTTCCAAGCAACCAAGTTCAATCCATTGGCTTTGATCAAGTTTTTCGAAATCGATGGGGCTCTCAACACCAAAGGGTCGACCAAGGAACCTTAACTATCTGGCTCGACAGTTCATCAGGTATACTGTAA ATGGCTCATTATTTTCTTATCCTTCTCTCTCTCTTTTTGTTCTTCTCTTTCACCTCTTGCCAGAATCCTCCCTCCCCTGGCTATTTTCCAAGCAACCAAGTTCAATCCATTGGCTTTGATCAAGTTTTTCGAAATCGATGGGGCTCTCAACACCAAAGGGTCGACCAAGGAACCTTAACTATCTGGCTCGACAGTTCATCAGGTATACTGTAA ATGGCTCATTATTTTCTTATCCTTCTCTCTCTCTTTTTGTTCTTCTCTTTCACCTCTTGCCAGAATCCTCCCTCCCCTGGCTATTTTCCAAGCAACCAAGTTCAATCCATTGGCTTTGATCAAGTTTTTCGAAATCGATGGGGCTCTCAACACCAAAGGGTCGACCAAGGAACCTTAACTATCTGGCTCGACAGTTCATCAGGTATACTGTAA MAHYFLILLSLFLFFSFTSCQNPPSPGYFPSNQVQSIGFDQVFRNRWGSQHQRVDQGTLTIWLDSSSGIL
BLAST of Cla97C03G053890 vs. NCBI nr
Match: XP_022964905.1 (probable xyloglucan endotransglucosylase/hydrolase protein 32 [Cucurbita moschata]) HSP 1 Score: 125.2 bits (313), Expect = 8.9e-26 Identity = 60/68 (88.24%), Postives = 61/68 (89.71%), Query Frame = 0
BLAST of Cla97C03G053890 vs. NCBI nr
Match: XP_023519903.1 (probable xyloglucan endotransglucosylase/hydrolase protein 32 isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 125.2 bits (313), Expect = 8.9e-26 Identity = 60/68 (88.24%), Postives = 61/68 (89.71%), Query Frame = 0
BLAST of Cla97C03G053890 vs. NCBI nr
Match: XP_023519902.1 (probable xyloglucan endotransglucosylase/hydrolase protein 32 isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 125.2 bits (313), Expect = 8.9e-26 Identity = 60/68 (88.24%), Postives = 61/68 (89.71%), Query Frame = 0
BLAST of Cla97C03G053890 vs. NCBI nr
Match: XP_022970265.1 (probable xyloglucan endotransglucosylase/hydrolase protein 32 [Cucurbita maxima]) HSP 1 Score: 119.8 bits (299), Expect = 3.7e-24 Identity = 58/68 (85.29%), Postives = 60/68 (88.24%), Query Frame = 0
BLAST of Cla97C03G053890 vs. NCBI nr
Match: XP_022949180.1 (xyloglucan endotransglucosylase/hydrolase protein 31-like [Cucurbita moschata]) HSP 1 Score: 105.9 bits (263), Expect = 5.6e-20 Identity = 50/68 (73.53%), Postives = 57/68 (83.82%), Query Frame = 0
BLAST of Cla97C03G053890 vs. TrEMBL
Match: tr|A0A0A0LV02|A0A0A0LV02_CUCSA (Xyloglucan endotransglucosylase/hydrolase OS=Cucumis sativus OX=3659 GN=Csa_1G109370 PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 1.0e-17 Identity = 43/46 (93.48%), Postives = 44/46 (95.65%), Query Frame = 0
BLAST of Cla97C03G053890 vs. TrEMBL
Match: tr|A0A1S3CI29|A0A1S3CI29_CUCME (Xyloglucan endotransglucosylase/hydrolase OS=Cucumis melo OX=3656 GN=LOC103501210 PE=3 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.7e-17 Identity = 48/68 (70.59%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of Cla97C03G053890 vs. TrEMBL
Match: tr|V4SKZ6|V4SKZ6_9ROSI (Xyloglucan endotransglucosylase/hydrolase OS=Citrus clementina OX=85681 GN=CICLE_v10028945mg PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.5e-16 Identity = 44/71 (61.97%), Postives = 53/71 (74.65%), Query Frame = 0
BLAST of Cla97C03G053890 vs. TrEMBL
Match: tr|A0A067EYQ1|A0A067EYQ1_CITSI (Xyloglucan endotransglucosylase/hydrolase OS=Citrus sinensis OX=2711 GN=CISIN_1g022492mg PE=3 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.5e-16 Identity = 44/71 (61.97%), Postives = 53/71 (74.65%), Query Frame = 0
BLAST of Cla97C03G053890 vs. TrEMBL
Match: tr|A0A2H5QRI0|A0A2H5QRI0_CITUN (Xyloglucan endotransglucosylase/hydrolase OS=Citrus unshiu OX=55188 GN=CUMW_252440 PE=3 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 3.2e-16 Identity = 44/71 (61.97%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of Cla97C03G053890 vs. Swiss-Prot
Match: sp|Q9SJL9|XTH32_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 32 OS=Arabidopsis thaliana OX=3702 GN=XTH32 PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.9e-12 Identity = 37/72 (51.39%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of Cla97C03G053890 vs. Swiss-Prot
Match: sp|P93046|XTH31_ARATH (Xyloglucan endotransglucosylase/hydrolase protein 31 OS=Arabidopsis thaliana OX=3702 GN=XTH31 PE=1 SV=2) HSP 1 Score: 65.9 bits (159), Expect = 2.1e-10 Identity = 33/68 (48.53%), Postives = 43/68 (63.24%), Query Frame = 0
BLAST of Cla97C03G053890 vs. TAIR10
Match: AT2G36870.1 (xyloglucan endotransglucosylase/hydrolase 32) HSP 1 Score: 72.0 bits (175), Expect = 1.6e-13 Identity = 37/72 (51.39%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of Cla97C03G053890 vs. TAIR10
Match: AT3G44990.1 (xyloglucan endo-transglycosylase-related 8) HSP 1 Score: 65.9 bits (159), Expect = 1.2e-11 Identity = 33/68 (48.53%), Postives = 43/68 (63.24%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|