Cla97C02G035950 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGTCCAAGCAAGGTACGATCTGTTACCTTATGGTTCTGGAAAATTTGGGCCTTTTTATTTCTGTCTCATCTTGTGTTTGGTAGTAGTAGTATATAATAGACTGAATTAGAATTCCCTATTTTACCGATTAAAATCGTGACTTTGAGAATCAAATGTGTTGTTTGTTTTTATAGGAGGGAAAGCAAAGCCTCTGAAGCAACCCAAGGTTGACAAGAAAGATTATGACGAGGTTTGCTTTTAATTTATTATTTTATGTATCTATGCTTTAATTCTAGTTTGTTCCTACTTTTCATTAGGTTAAACTACCATTTTGGTCAATGTAATTTCATTCTATTTTAGTTCAATCCCTTTTCTTACAATATATCTTAAAAGTAAAGGATTTCATTGAACTTTCAAATCAGTGACCGGCTTAGCTAGCCCACTTTCAGGCTCTCATCAAAATTTCCCTTCTTCTGAGAGGAGAAAAGAATATTAAAGTTGATGGTAGTTTTTTTCGAACCTTTTTTCTGTTCTAATGGTAAGCACCATTATTGTCCATTCCATTCACCGGTGGGAGGGGAGTTCGAGCTAAAATTATGAATGGTTGCCCTCACCTGAAATTGCTATCTTTTCCATTCATTGGCTATTTTTAATTAATGGTTGCTTGGTGAAGGGACAATGGGGGGAACTGTAACTCTCTCTACCTTAATTTGTTATGAAGAAATTCCTTTATGTAGTCAACTTAATAGCATGGCAAGGTGACTGGACTACTGTTTGAATTTTACTGTGTTTTCTCAACAGGTTGATCTCGCCAATATTCAAAAGAAGAAGGAAGAGGAAAAGGTGAGAACTTGAACTTTAAAGTTTAAACTGTCACATGATATTTTTTGTTCTGGTCCATCGATTACTATAATTTTGGGGAGTTTGATGTTATACAGGCTCTCAGAGATCTTAGAGCAAAGGCTCAACAGAAGGGGACCTTTGGAGGTGCTGGGCTAAAAAAGAGTGGGAAAAAATGA ATGTCGTCCAAGCAAGGAGGGAAAGCAAAGCCTCTGAAGCAACCCAAGGTTGACAAGAAAGATTATGACGAGGTTGATCTCGCCAATATTCAAAAGAAGAAGGAAGAGGAAAAGGCTCTCAGAGATCTTAGAGCAAAGGCTCAACAGAAGGGGACCTTTGGAGGTGCTGGGCTAAAAAAGAGTGGGAAAAAATGA ATGTCGTCCAAGCAAGGAGGGAAAGCAAAGCCTCTGAAGCAACCCAAGGTTGACAAGAAAGATTATGACGAGGTTGATCTCGCCAATATTCAAAAGAAGAAGGAAGAGGAAAAGGCTCTCAGAGATCTTAGAGCAAAGGCTCAACAGAAGGGGACCTTTGGAGGTGCTGGGCTAAAAAAGAGTGGGAAAAAATGA MSSKQGGKAKPLKQPKVDKKDYDEVDLANIQKKKEEEKALRDLRAKAQQKGTFGGAGLKKSGKK
BLAST of Cla97C02G035950 vs. NCBI nr
Match: XP_022145738.1 (translation machinery-associated protein 7 [Momordica charantia]) HSP 1 Score: 113.6 bits (283), Expect = 2.5e-22 Identity = 60/64 (93.75%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Cla97C02G035950 vs. NCBI nr
Match: KGN56723.1 (F9L1.21 protein [Cucumis sativus]) HSP 1 Score: 112.8 bits (281), Expect = 4.2e-22 Identity = 59/64 (92.19%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Cla97C02G035950 vs. NCBI nr
Match: XP_022924253.1 (translation machinery-associated protein 7-like [Cucurbita moschata]) HSP 1 Score: 111.7 bits (278), Expect = 9.3e-22 Identity = 59/64 (92.19%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of Cla97C02G035950 vs. NCBI nr
Match: XP_022980452.1 (translation machinery-associated protein 7-like [Cucurbita maxima]) HSP 1 Score: 111.7 bits (278), Expect = 9.3e-22 Identity = 59/64 (92.19%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of Cla97C02G035950 vs. NCBI nr
Match: XP_022947069.1 (translation machinery-associated protein 7-like [Cucurbita moschata] >XP_022947070.1 translation machinery-associated protein 7-like [Cucurbita moschata] >XP_022947071.1 translation machinery-associated protein 7-like [Cucurbita moschata] >XP_022947072.1 translation machinery-associated protein 7-like [Cucurbita moschata] >XP_022947073.1 translation machinery-associated protein 7-like [Cucurbita moschata] >XP_022971147.1 translation machinery-associated protein 7-like [Cucurbita maxima] >XP_022971149.1 translation machinery-associated protein 7-like [Cucurbita maxima] >XP_022971150.1 translation machinery-associated protein 7-like [Cucurbita maxima] >XP_022971151.1 translation machinery-associated protein 7-like [Cucurbita maxima] >XP_022971152.1 translation machinery-associated protein 7-like [Cucurbita maxima]) HSP 1 Score: 111.3 bits (277), Expect = 1.2e-21 Identity = 58/64 (90.62%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of Cla97C02G035950 vs. TrEMBL
Match: tr|A0A0A0L4M8|A0A0A0L4M8_CUCSA (F9L1.21 protein OS=Cucumis sativus OX=3659 GN=Csa_3G130290 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 2.8e-22 Identity = 59/64 (92.19%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Cla97C02G035950 vs. TrEMBL
Match: tr|A0A2P5ELN0|A0A2P5ELN0_9ROSA (Translation machinery associated TMA OS=Trema orientalis OX=63057 GN=TorRG33x02_177400 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 1.1e-21 Identity = 58/64 (90.62%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Cla97C02G035950 vs. TrEMBL
Match: tr|W9S4Y5|W9S4Y5_9ROSA (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_000574 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 2.3e-21 Identity = 57/64 (89.06%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of Cla97C02G035950 vs. TrEMBL
Match: tr|A0A2P5AEL5|A0A2P5AEL5_PARAD (Translation machinery associated TMA OS=Parasponia andersonii OX=3476 GN=PanWU01x14_339940 PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 3.1e-21 Identity = 57/64 (89.06%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of Cla97C02G035950 vs. TrEMBL
Match: tr|V4SI02|V4SI02_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10026914mg PE=4 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 8.9e-21 Identity = 57/64 (89.06%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of Cla97C02G035950 vs. Swiss-Prot
Match: sp|Q4SUE2|TMA7_TETNG (Translation machinery-associated protein 7 OS=Tetraodon nigroviridis OX=99883 GN=tma7 PE=3 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.1e-10 Identity = 36/64 (56.25%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of Cla97C02G035950 vs. Swiss-Prot
Match: sp|Q28GR1|TMA7_XENTR (Translation machinery-associated protein 7 OS=Xenopus tropicalis OX=8364 GN=tma7 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.5e-10 Identity = 36/64 (56.25%), Postives = 47/64 (73.44%), Query Frame = 0
BLAST of Cla97C02G035950 vs. Swiss-Prot
Match: sp|Q9XZS3|TMA7_DROME (Translation machinery-associated protein 7 homolog OS=Drosophila melanogaster OX=7227 GN=CG13364 PE=4 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 1.9e-10 Identity = 37/64 (57.81%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of Cla97C02G035950 vs. Swiss-Prot
Match: sp|Q05AK9|TMA7_DANRE (Translation machinery-associated protein 7 OS=Danio rerio OX=7955 GN=tma7 PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.2e-09 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of Cla97C02G035950 vs. Swiss-Prot
Match: sp|Q60QR6|TMA7_CAEBR (Translation machinery-associated protein 7 homolog OS=Caenorhabditis briggsae OX=6238 GN=CBG21705 PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.1e-08 Identity = 34/64 (53.12%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of Cla97C02G035950 vs. TAIR10
Match: AT1G15270.1 (Translation machinery associated TMA7) HSP 1 Score: 105.5 bits (262), Expect = 1.2e-23 Identity = 55/64 (85.94%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of Cla97C02G035950 vs. TAIR10
Match: AT3G16040.1 (Translation machinery associated TMA7) HSP 1 Score: 91.7 bits (226), Expect = 1.8e-19 Identity = 49/64 (76.56%), Postives = 57/64 (89.06%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|