Cla97C02G034110 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAACCAGAACCCTATCCTACATTGCCCCCATCTTCGCCGAAAGCTACCCAACTACACTGCTGCCCACAATGCAATCCGCGCGAAAGTTAGTGTCCTGTCCCTCCATTAATAACCACTCTGGCTGCTTATGCTCAGAACTATGCCAACACGAAGATCACTACTTGTAAAATGGAGCACTCTAGAGGACCTTATGGCGAGAACCTAACGAAGGGGTACAAAATGATGACAGCAGAGACAACAATGAGTCTCTAA ATGGCTAACCAGAACCCTATCCTACATTGCCCCCATCTTCGCCGAAAGCTACCCAACTACACTGCTGCCCACAATGCAATCCGCGCGAAAAACTATGCCAACACGAAGATCACTACTTGTAAAATGGAGCACTCTAGAGGACCTTATGGCGAGAACCTAACGAAGGGGTACAAAATGATGACAGCAGAGACAACAATGAGTCTCTAA ATGGCTAACCAGAACCCTATCCTACATTGCCCCCATCTTCGCCGAAAGCTACCCAACTACACTGCTGCCCACAATGCAATCCGCGCGAAAAACTATGCCAACACGAAGATCACTACTTGTAAAATGGAGCACTCTAGAGGACCTTATGGCGAGAACCTAACGAAGGGGTACAAAATGATGACAGCAGAGACAACAATGAGTCTCTAA MANQNPILHCPHLRRKLPNYTAAHNAIRAKNYANTKITTCKMEHSRGPYGENLTKGYKMMTAETTMSL
BLAST of Cla97C02G034110 vs. NCBI nr
Match: XP_008455069.1 (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis melo]) HSP 1 Score: 70.1 bits (170), Expect = 3.3e-09 Identity = 40/76 (52.63%), Postives = 46/76 (60.53%), Query Frame = 0
BLAST of Cla97C02G034110 vs. NCBI nr
Match: XP_004137080.2 (PREDICTED: pathogenesis-related protein 1A-like [Cucumis sativus] >KGN43826.1 hypothetical protein Csa_7G070232 [Cucumis sativus]) HSP 1 Score: 68.6 bits (166), Expect = 9.6e-09 Identity = 36/67 (53.73%), Postives = 43/67 (64.18%), Query Frame = 0
BLAST of Cla97C02G034110 vs. NCBI nr
Match: XP_022927709.1 (pathogenesis-related protein 1A-like [Cucurbita moschata]) HSP 1 Score: 59.7 bits (143), Expect = 4.5e-06 Identity = 32/67 (47.76%), Postives = 39/67 (58.21%), Query Frame = 0
BLAST of Cla97C02G034110 vs. NCBI nr
Match: XP_022988978.1 (basic form of pathogenesis-related protein 1-like [Cucurbita maxima]) HSP 1 Score: 59.3 bits (142), Expect = 5.8e-06 Identity = 32/67 (47.76%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of Cla97C02G034110 vs. NCBI nr
Match: XP_008455070.1 (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis melo]) HSP 1 Score: 57.0 bits (136), Expect = 2.9e-05 Identity = 31/75 (41.33%), Postives = 42/75 (56.00%), Query Frame = 0
BLAST of Cla97C02G034110 vs. TrEMBL
Match: tr|A0A1S3C0S3|A0A1S3C0S3_CUCME (basic form of pathogenesis-related protein 1-like OS=Cucumis melo OX=3656 GN=LOC103495334 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 2.2e-09 Identity = 40/76 (52.63%), Postives = 46/76 (60.53%), Query Frame = 0
BLAST of Cla97C02G034110 vs. TrEMBL
Match: tr|A0A0A0K7N5|A0A0A0K7N5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G070232 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 6.4e-09 Identity = 36/67 (53.73%), Postives = 43/67 (64.18%), Query Frame = 0
BLAST of Cla97C02G034110 vs. TrEMBL
Match: tr|A0A1S3C197|A0A1S3C197_CUCME (basic form of pathogenesis-related protein 1-like OS=Cucumis melo OX=3656 GN=LOC103495335 PE=4 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.9e-05 Identity = 31/75 (41.33%), Postives = 42/75 (56.00%), Query Frame = 0
BLAST of Cla97C02G034110 vs. TrEMBL
Match: tr|A0A2P5C2B7|A0A2P5C2B7_PARAD (Cysteine-rich secretory protein, allergen V5/Tpx-1-related OS=Parasponia andersonii OX=3476 GN=PanWU01x14_190720 PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 3.3e-05 Identity = 29/62 (46.77%), Postives = 36/62 (58.06%), Query Frame = 0
BLAST of Cla97C02G034110 vs. TrEMBL
Match: tr|A0A2P5AAT5|A0A2P5AAT5_9ROSA (Cysteine-rich secretory protein, allergen V5/Tpx-1-related OS=Trema orientalis OX=63057 GN=TorRG33x02_354600 PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 4.3e-05 Identity = 29/62 (46.77%), Postives = 36/62 (58.06%), Query Frame = 0
BLAST of Cla97C02G034110 vs. TAIR10
Match: AT2G14580.1 (basic pathogenesis-related protein 1) HSP 1 Score: 40.4 bits (93), Expect = 5.1e-04 Identity = 18/30 (60.00%), Postives = 21/30 (70.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |