Cla97C02G031910 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCAATGTCTGCACATGGGTCTAGTGCATGGACTCCAATGGAAAACAAAGCCTTTGAGAAAGCTTTGGCAGTTTATGATCAAGATACACCTGAAAGATGGCTCAATGTTGCAAAGGCCATTGGTGGCAAAACTGAAGAAGAAGTGAAGAGGCATTATCAACTTCTTGTGGAGGATGTTAAGCATATTGAGTCTGGTGAAATTCCTTTCCCCTATCAAAACTCTACGAGATCGAGTCGTTGA ATGGCTTCAATGTCTGCACATGGGTCTAGTGCATGGACTCCAATGGAAAACAAAGCCTTTGAGAAAGCTTTGGCAGTTTATGATCAAGATACACCTGAAAGATGGCTCAATGTTGCAAAGGCCATTGGTGGCAAAACTGAAGAAGAAGTGAAGAGGCATTATCAACTTCTTGTGGAGGATGTTAAGCATATTGAGTCTGGTGAAATTCCTTTCCCCTATCAAAACTCTACGAGATCGAGTCGTTGA ATGGCTTCAATGTCTGCACATGGGTCTAGTGCATGGACTCCAATGGAAAACAAAGCCTTTGAGAAAGCTTTGGCAGTTTATGATCAAGATACACCTGAAAGATGGCTCAATGTTGCAAAGGCCATTGGTGGCAAAACTGAAGAAGAAGTGAAGAGGCATTATCAACTTCTTGTGGAGGATGTTAAGCATATTGAGTCTGGTGAAATTCCTTTCCCCTATCAAAACTCTACGAGATCGAGTCGTTGA MASMSAHGSSAWTPMENKAFEKALAVYDQDTPERWLNVAKAIGGKTEEEVKRHYQLLVEDVKHIESGEIPFPYQNSTRSSR
BLAST of Cla97C02G031910 vs. NCBI nr
Match: XP_011658943.1 (PREDICTED: protein RADIALIS-like 1 [Cucumis sativus] >KGN44073.1 hypothetical protein Csa_7G168060 [Cucumis sativus]) HSP 1 Score: 151.8 bits (382), Expect = 1.0e-33 Identity = 72/81 (88.89%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of Cla97C02G031910 vs. NCBI nr
Match: XP_008447026.1 (PREDICTED: protein RADIALIS-like 1 [Cucumis melo]) HSP 1 Score: 148.7 bits (374), Expect = 8.7e-33 Identity = 69/81 (85.19%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of Cla97C02G031910 vs. NCBI nr
Match: XP_022952660.1 (protein RADIALIS-like 1 [Cucurbita moschata] >XP_022952661.1 protein RADIALIS-like 1 [Cucurbita moschata] >XP_023554744.1 protein RADIALIS-like 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 143.7 bits (361), Expect = 2.8e-31 Identity = 69/78 (88.46%), Postives = 75/78 (96.15%), Query Frame = 0
BLAST of Cla97C02G031910 vs. NCBI nr
Match: XP_022972544.1 (protein RADIALIS-like 1 [Cucurbita maxima] >XP_022972545.1 protein RADIALIS-like 1 [Cucurbita maxima]) HSP 1 Score: 142.1 bits (357), Expect = 8.2e-31 Identity = 68/78 (87.18%), Postives = 74/78 (94.87%), Query Frame = 0
BLAST of Cla97C02G031910 vs. NCBI nr
Match: XP_022952273.1 (protein RADIALIS-like 1 [Cucurbita moschata] >XP_023511439.1 protein RADIALIS-like 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 141.0 bits (354), Expect = 1.8e-30 Identity = 65/77 (84.42%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of Cla97C02G031910 vs. TrEMBL
Match: tr|A0A0A0K3K0|A0A0A0K3K0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G168060 PE=4 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 6.8e-34 Identity = 72/81 (88.89%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of Cla97C02G031910 vs. TrEMBL
Match: tr|A0A1S3BGF0|A0A1S3BGF0_CUCME (protein RADIALIS-like 1 OS=Cucumis melo OX=3656 GN=LOC103489577 PE=4 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 5.8e-33 Identity = 69/81 (85.19%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of Cla97C02G031910 vs. TrEMBL
Match: tr|A0A1S3BGF6|A0A1S3BGF6_CUCME (protein RADIALIS-like 1 OS=Cucumis melo OX=3656 GN=LOC103489576 PE=4 SV=1) HSP 1 Score: 137.1 bits (344), Expect = 1.7e-29 Identity = 63/76 (82.89%), Postives = 71/76 (93.42%), Query Frame = 0
BLAST of Cla97C02G031910 vs. TrEMBL
Match: tr|A0A0A0K344|A0A0A0K344_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G169070 PE=4 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 8.6e-29 Identity = 61/76 (80.26%), Postives = 72/76 (94.74%), Query Frame = 0
BLAST of Cla97C02G031910 vs. TrEMBL
Match: tr|A0A1S3BHZ4|A0A1S3BHZ4_CUCME (protein RADIALIS-like 2 OS=Cucumis melo OX=3656 GN=LOC103489762 PE=4 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 7.3e-28 Identity = 60/77 (77.92%), Postives = 69/77 (89.61%), Query Frame = 0
BLAST of Cla97C02G031910 vs. Swiss-Prot
Match: sp|Q9SIJ5|RADL2_ARATH (Protein RADIALIS-like 2 OS=Arabidopsis thaliana OX=3702 GN=RL2 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 4.3e-23 Identity = 50/79 (63.29%), Postives = 65/79 (82.28%), Query Frame = 0
BLAST of Cla97C02G031910 vs. Swiss-Prot
Match: sp|F4JVB8|RADL1_ARATH (Protein RADIALIS-like 1 OS=Arabidopsis thaliana OX=3702 GN=RL1 PE=2 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 7.3e-23 Identity = 47/71 (66.20%), Postives = 58/71 (81.69%), Query Frame = 0
BLAST of Cla97C02G031910 vs. Swiss-Prot
Match: sp|Q58FS3|RAD_ANTMA (Transcription factor RADIALIS OS=Antirrhinum majus OX=4151 GN=RAD PE=1 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.8e-21 Identity = 47/77 (61.04%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of Cla97C02G031910 vs. Swiss-Prot
Match: sp|Q6NNN0|RADL3_ARATH (Protein RADIALIS-like 3 OS=Arabidopsis thaliana OX=3702 GN=RL3 PE=2 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 8.9e-21 Identity = 47/76 (61.84%), Postives = 57/76 (75.00%), Query Frame = 0
BLAST of Cla97C02G031910 vs. Swiss-Prot
Match: sp|Q1A173|RADL6_ARATH (Protein RADIALIS-like 6 OS=Arabidopsis thaliana OX=3702 GN=RL6 PE=2 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 8.9e-21 Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 0
BLAST of Cla97C02G031910 vs. TAIR10
Match: AT2G21650.1 (Homeodomain-like superfamily protein) HSP 1 Score: 108.2 bits (269), Expect = 2.4e-24 Identity = 50/79 (63.29%), Postives = 65/79 (82.28%), Query Frame = 0
BLAST of Cla97C02G031910 vs. TAIR10
Match: AT4G39250.1 (RAD-like 1) HSP 1 Score: 107.5 bits (267), Expect = 4.0e-24 Identity = 47/71 (66.20%), Postives = 58/71 (81.69%), Query Frame = 0
BLAST of Cla97C02G031910 vs. TAIR10
Match: AT1G75250.1 (RAD-like 6) HSP 1 Score: 100.5 bits (249), Expect = 4.9e-22 Identity = 50/82 (60.98%), Postives = 62/82 (75.61%), Query Frame = 0
BLAST of Cla97C02G031910 vs. TAIR10
Match: AT1G19510.1 (RAD-like 5) HSP 1 Score: 98.2 bits (243), Expect = 2.5e-21 Identity = 45/72 (62.50%), Postives = 56/72 (77.78%), Query Frame = 0
BLAST of Cla97C02G031910 vs. TAIR10
Match: AT2G18328.1 (RAD-like 4) HSP 1 Score: 88.6 bits (218), Expect = 1.9e-18 Identity = 44/77 (57.14%), Postives = 59/77 (76.62%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |