Cla97C02G031340 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTCCGCTTGCCTAGCATTGTTCATGCTAAGCAAAGTTTTCGGCGATCTTCGTCAACAGGAAATGGAGCATCTCCAAAGGCTATAGATGTTCCAAAGGACTACTTTGCAGTTTATGTTGGTGAGGCACAAAAGAAACGTTTTGTCATCCCACTATCTTGCTTGAACCAACCTTCATTTCAAGATTTATTGAGTCAAGCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGAAACTTTTCTCAGTCTCATGCAAAGCTGA ATGGGTTTCCGCTTGCCTAGCATTGTTCATGCTAAGCAAAGTTTTCGGCGATCTTCGTCAACAGGAAATGGAGCATCTCCAAAGGCTATAGATGTTCCAAAGGACTACTTTGCAGTTTATGTTGGTGAGGCACAAAAGAAACGTTTTGTCATCCCACTATCTTGCTTGAACCAACCTTCATTTCAAGATTTATTGAGTCAAGCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGAAACTTTTCTCAGTCTCATGCAAAGCTGA ATGGGTTTCCGCTTGCCTAGCATTGTTCATGCTAAGCAAAGTTTTCGGCGATCTTCGTCAACAGGAAATGGAGCATCTCCAAAGGCTATAGATGTTCCAAAGGACTACTTTGCAGTTTATGTTGGTGAGGCACAAAAGAAACGTTTTGTCATCCCACTATCTTGCTTGAACCAACCTTCATTTCAAGATTTATTGAGTCAAGCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGAAACTTTTCTCAGTCTCATGCAAAGCTGA MGFRLPSIVHAKQSFRRSSSTGNGASPKAIDVPKDYFAVYVGEAQKKRFVIPLSCLNQPSFQDLLSQAEEEFGYDHPMGGITIPCSEETFLSLMQS
BLAST of Cla97C02G031340 vs. NCBI nr
Match: XP_022135743.1 (auxin-induced protein 15A-like [Momordica charantia]) HSP 1 Score: 179.1 bits (453), Expect = 7.1e-42 Identity = 85/96 (88.54%), Postives = 88/96 (91.67%), Query Frame = 0
BLAST of Cla97C02G031340 vs. NCBI nr
Match: XP_022989148.1 (auxin-induced protein 15A-like [Cucurbita maxima]) HSP 1 Score: 177.6 bits (449), Expect = 2.1e-41 Identity = 84/96 (87.50%), Postives = 89/96 (92.71%), Query Frame = 0
BLAST of Cla97C02G031340 vs. NCBI nr
Match: XP_022135742.1 (indole-3-acetic acid-induced protein ARG7-like [Momordica charantia]) HSP 1 Score: 176.4 bits (446), Expect = 4.6e-41 Identity = 82/95 (86.32%), Postives = 88/95 (92.63%), Query Frame = 0
BLAST of Cla97C02G031340 vs. NCBI nr
Match: XP_022989153.1 (auxin-induced protein 15A-like [Cucurbita maxima]) HSP 1 Score: 176.0 bits (445), Expect = 6.0e-41 Identity = 80/96 (83.33%), Postives = 89/96 (92.71%), Query Frame = 0
BLAST of Cla97C02G031340 vs. NCBI nr
Match: KGN43199.1 (hypothetical protein Csa_7G008460 [Cucumis sativus]) HSP 1 Score: 170.6 bits (431), Expect = 2.5e-39 Identity = 81/96 (84.38%), Postives = 85/96 (88.54%), Query Frame = 0
BLAST of Cla97C02G031340 vs. TrEMBL
Match: tr|A0A0A0K2F0|A0A0A0K2F0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G008460 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 1.7e-39 Identity = 81/96 (84.38%), Postives = 85/96 (88.54%), Query Frame = 0
BLAST of Cla97C02G031340 vs. TrEMBL
Match: tr|A0A0A0K4J0|A0A0A0K4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G008980 PE=4 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 1.9e-38 Identity = 80/96 (83.33%), Postives = 86/96 (89.58%), Query Frame = 0
BLAST of Cla97C02G031340 vs. TrEMBL
Match: tr|A0A1S3BIR0|A0A1S3BIR0_CUCME (auxin-induced protein 15A-like OS=Cucumis melo OX=3656 GN=LOC103490324 PE=4 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 4.1e-38 Identity = 79/95 (83.16%), Postives = 86/95 (90.53%), Query Frame = 0
BLAST of Cla97C02G031340 vs. TrEMBL
Match: tr|A0A0A0K5T8|A0A0A0K5T8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G009020 PE=4 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 9.2e-38 Identity = 79/96 (82.29%), Postives = 83/96 (86.46%), Query Frame = 0
BLAST of Cla97C02G031340 vs. TrEMBL
Match: tr|A0A0A0K160|A0A0A0K160_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G008990 PE=4 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 6.0e-37 Identity = 76/95 (80.00%), Postives = 84/95 (88.42%), Query Frame = 0
BLAST of Cla97C02G031340 vs. Swiss-Prot
Match: sp|P32295|ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata OX=3916 GN=ARG7 PE=2 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.2e-26 Identity = 61/90 (67.78%), Postives = 67/90 (74.44%), Query Frame = 0
BLAST of Cla97C02G031340 vs. Swiss-Prot
Match: sp|P33080|AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.9e-26 Identity = 57/93 (61.29%), Postives = 72/93 (77.42%), Query Frame = 0
BLAST of Cla97C02G031340 vs. Swiss-Prot
Match: sp|P33083|AX6B_SOYBN (Auxin-induced protein 6B OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.9e-25 Identity = 59/90 (65.56%), Postives = 69/90 (76.67%), Query Frame = 0
BLAST of Cla97C02G031340 vs. Swiss-Prot
Match: sp|P33079|A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 9.2e-25 Identity = 57/93 (61.29%), Postives = 70/93 (75.27%), Query Frame = 0
BLAST of Cla97C02G031340 vs. Swiss-Prot
Match: sp|P33081|AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.6e-24 Identity = 60/90 (66.67%), Postives = 66/90 (73.33%), Query Frame = 0
BLAST of Cla97C02G031340 vs. TAIR10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 116.7 bits (291), Expect = 7.9e-27 Identity = 53/94 (56.38%), Postives = 69/94 (73.40%), Query Frame = 0
BLAST of Cla97C02G031340 vs. TAIR10
Match: AT5G18080.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 108.2 bits (269), Expect = 2.8e-24 Identity = 49/87 (56.32%), Postives = 68/87 (78.16%), Query Frame = 0
BLAST of Cla97C02G031340 vs. TAIR10
Match: AT5G18020.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 106.7 bits (265), Expect = 8.2e-24 Identity = 48/87 (55.17%), Postives = 68/87 (78.16%), Query Frame = 0
BLAST of Cla97C02G031340 vs. TAIR10
Match: AT2G21200.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.1 bits (261), Expect = 2.4e-23 Identity = 45/65 (69.23%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Cla97C02G031340 vs. TAIR10
Match: AT5G18050.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.1 bits (261), Expect = 2.4e-23 Identity = 48/87 (55.17%), Postives = 68/87 (78.16%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |