Cla97C02G031330 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTCCGCTTGCCTAGAATTGTTCATGCTAAGCAAAGTCTTCAGCGATCTTCATCAACAGGAAATGGAGCATCTCCAAAGGCTGTTGATGTTCCTAAGGGCTATTTTACCGTTTATGTCGGTGAGGAACAAAAGAAGCGTTTTATCATCCCACTATCTTACTTGAACCAACCTTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCGATGGGCGGCATCACAATTCCTTGTAGTGAAGAAATTTTCCTAAATCTCACGCAGAGTTTGAATGACTCATGA ATGGGTTTCCGCTTGCCTAGAATTGTTCATGCTAAGCAAAGTCTTCAGCGATCTTCATCAACAGGAAATGGAGCATCTCCAAAGGCTGTTGATGTTCCTAAGGGCTATTTTACCGTTTATGTCGGTGAGGAACAAAAGAAGCGTTTTATCATCCCACTATCTTACTTGAACCAACCTTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCGATGGGCGGCATCACAATTCCTTGTAGTGAAGAAATTTTCCTAAATCTCACGCAGAGTTTGAATGACTCATGA ATGGGTTTCCGCTTGCCTAGAATTGTTCATGCTAAGCAAAGTCTTCAGCGATCTTCATCAACAGGAAATGGAGCATCTCCAAAGGCTGTTGATGTTCCTAAGGGCTATTTTACCGTTTATGTCGGTGAGGAACAAAAGAAGCGTTTTATCATCCCACTATCTTACTTGAACCAACCTTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCGATGGGCGGCATCACAATTCCTTGTAGTGAAGAAATTTTCCTAAATCTCACGCAGAGTTTGAATGACTCATGA MGFRLPRIVHAKQSLQRSSSTGNGASPKAVDVPKGYFTVYVGEEQKKRFIIPLSYLNQPSFQDLLSQAEEEFGYNHPMGGITIPCSEEIFLNLTQSLNDS
BLAST of Cla97C02G031330 vs. NCBI nr
Match: XP_022952255.1 (auxin-induced protein X10A-like [Cucurbita moschata]) HSP 1 Score: 191.8 bits (486), Expect = 1.1e-45 Identity = 92/100 (92.00%), Postives = 96/100 (96.00%), Query Frame = 0
BLAST of Cla97C02G031330 vs. NCBI nr
Match: XP_022952257.1 (auxin-induced protein 15A-like [Cucurbita moschata]) HSP 1 Score: 191.8 bits (486), Expect = 1.1e-45 Identity = 92/100 (92.00%), Postives = 96/100 (96.00%), Query Frame = 0
BLAST of Cla97C02G031330 vs. NCBI nr
Match: XP_011658575.1 (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus] >KGN43202.1 hypothetical protein Csa_7G008980 [Cucumis sativus]) HSP 1 Score: 191.4 bits (485), Expect = 1.4e-45 Identity = 91/100 (91.00%), Postives = 96/100 (96.00%), Query Frame = 0
BLAST of Cla97C02G031330 vs. NCBI nr
Match: XP_023553777.1 (auxin-induced protein X10A-like [Cucurbita pepo subsp. pepo] >XP_023553882.1 auxin-induced protein X10A-like [Cucurbita pepo subsp. pepo] >XP_023554331.1 auxin-induced protein X10A-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 191.4 bits (485), Expect = 1.4e-45 Identity = 92/100 (92.00%), Postives = 95/100 (95.00%), Query Frame = 0
BLAST of Cla97C02G031330 vs. NCBI nr
Match: XP_022135743.1 (auxin-induced protein 15A-like [Momordica charantia]) HSP 1 Score: 190.7 bits (483), Expect = 2.5e-45 Identity = 90/100 (90.00%), Postives = 97/100 (97.00%), Query Frame = 0
BLAST of Cla97C02G031330 vs. TrEMBL
Match: tr|A0A0A0K4J0|A0A0A0K4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G008980 PE=4 SV=1) HSP 1 Score: 191.4 bits (485), Expect = 9.6e-46 Identity = 91/100 (91.00%), Postives = 96/100 (96.00%), Query Frame = 0
BLAST of Cla97C02G031330 vs. TrEMBL
Match: tr|A0A0A0K5T8|A0A0A0K5T8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G009020 PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 2.8e-45 Identity = 91/100 (91.00%), Postives = 95/100 (95.00%), Query Frame = 0
BLAST of Cla97C02G031330 vs. TrEMBL
Match: tr|A0A1S3BIR8|A0A1S3BIR8_CUCME (auxin-induced protein 15A-like OS=Cucumis melo OX=3656 GN=LOC103490323 PE=4 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 4.8e-45 Identity = 92/99 (92.93%), Postives = 94/99 (94.95%), Query Frame = 0
BLAST of Cla97C02G031330 vs. TrEMBL
Match: tr|A0A1S3BIR0|A0A1S3BIR0_CUCME (auxin-induced protein 15A-like OS=Cucumis melo OX=3656 GN=LOC103490324 PE=4 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 4.8e-45 Identity = 88/100 (88.00%), Postives = 96/100 (96.00%), Query Frame = 0
BLAST of Cla97C02G031330 vs. TrEMBL
Match: tr|A0A0A0K160|A0A0A0K160_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G008990 PE=4 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 1.4e-44 Identity = 88/100 (88.00%), Postives = 96/100 (96.00%), Query Frame = 0
BLAST of Cla97C02G031330 vs. Swiss-Prot
Match: sp|P33080|AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 6.4e-29 Identity = 61/99 (61.62%), Postives = 77/99 (77.78%), Query Frame = 0
BLAST of Cla97C02G031330 vs. Swiss-Prot
Match: sp|P33083|AX6B_SOYBN (Auxin-induced protein 6B OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.4e-28 Identity = 61/98 (62.24%), Postives = 77/98 (78.57%), Query Frame = 0
BLAST of Cla97C02G031330 vs. Swiss-Prot
Match: sp|P32295|ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata OX=3916 GN=ARG7 PE=2 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.7e-27 Identity = 59/98 (60.20%), Postives = 74/98 (75.51%), Query Frame = 0
BLAST of Cla97C02G031330 vs. Swiss-Prot
Match: sp|P33079|A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 6.0e-27 Identity = 61/99 (61.62%), Postives = 75/99 (75.76%), Query Frame = 0
BLAST of Cla97C02G031330 vs. Swiss-Prot
Match: sp|P33081|AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.3e-26 Identity = 61/98 (62.24%), Postives = 69/98 (70.41%), Query Frame = 0
BLAST of Cla97C02G031330 vs. TAIR10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 125.6 bits (314), Expect = 1.8e-29 Identity = 55/99 (55.56%), Postives = 76/99 (76.77%), Query Frame = 0
BLAST of Cla97C02G031330 vs. TAIR10
Match: AT5G18080.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 113.2 bits (282), Expect = 9.1e-26 Identity = 51/90 (56.67%), Postives = 69/90 (76.67%), Query Frame = 0
BLAST of Cla97C02G031330 vs. TAIR10
Match: AT5G18010.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 111.7 bits (278), Expect = 2.6e-25 Identity = 51/90 (56.67%), Postives = 69/90 (76.67%), Query Frame = 0
BLAST of Cla97C02G031330 vs. TAIR10
Match: AT4G34800.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.9 bits (276), Expect = 4.5e-25 Identity = 54/98 (55.10%), Postives = 69/98 (70.41%), Query Frame = 0
BLAST of Cla97C02G031330 vs. TAIR10
Match: AT5G18020.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.5 bits (275), Expect = 5.9e-25 Identity = 49/87 (56.32%), Postives = 68/87 (78.16%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |