Cla97C01G022520 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATATACCTTCAACATGCAGGCCTATTTTCCATCAATTTTCCAGCCCGAGGGATTACCTCTAAAAGTACAGGATGCAAATGGAAAGGAAAGGAATGGATATTTCAGTTCCGTTTTTGGCCTAATAACAATACCGGGATGTATGTTCTTGAGGGGGTTACTCCCTGCATACAGTCCATGCAATTGCAAGCAGTTGACACAGGTTTGAGGTGGCATTTGCTTCTTTTGGGGTTCTTTTTTTTTAACTGGAAGTGGTTTGTAATCTTTTTCAACAATTGGCACTACCGAGACTTGCCAAGGCCAGTCTATTAG ATGATATACCTTCAACATGCAGGCCTATTTTCCATCAATTTTCCAGCCCGAGGGATTACCTCTAAAAGTACAGGATGCAAATGGAAAGGAAAGGAATGGATATTTCAGTTCCGTTTTTGGCCTAATAACAATACCGGGATGTATGTTCTTGAGGGGGTTACTCCCTGCATACAGTCCATGCAATTGCAAGCAGTTGACACAGGTTTGAGGTGGCATTTGCTTCTTTTGGGGTTCTTTTTTTTTAACTGGAAGTGGTTTGTAATCTTTTTCAACAATTGGCACTACCGAGACTTGCCAAGGCCAGTCTATTAG ATGATATACCTTCAACATGCAGGCCTATTTTCCATCAATTTTCCAGCCCGAGGGATTACCTCTAAAAGTACAGGATGCAAATGGAAAGGAAAGGAATGGATATTTCAGTTCCGTTTTTGGCCTAATAACAATACCGGGATGTATGTTCTTGAGGGGGTTACTCCCTGCATACAGTCCATGCAATTGCAAGCAGTTGACACAGGTTTGAGGTGGCATTTGCTTCTTTTGGGGTTCTTTTTTTTTAACTGGAAGTGGTTTGTAATCTTTTTCAACAATTGGCACTACCGAGACTTGCCAAGGCCAGTCTATTAG MIYLQHAGLFSINFPARGITSKSTGCKWKGKEWIFQFRFWPNNNTGMYVLEGVTPCIQSMQLQAVDTGLRWHLLLLGFFFFNWKWFVIFFNNWHYRDLPRPVY
BLAST of Cla97C01G022520 vs. NCBI nr
Match: KHN19388.1 (F-box protein SKIP22 [Glycine soja]) HSP 1 Score: 84.3 bits (207), Expect = 2.6e-13 Identity = 36/40 (90.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of Cla97C01G022520 vs. NCBI nr
Match: XP_015888018.1 (B3 domain-containing protein Os07g0563300-like [Ziziphus jujuba]) HSP 1 Score: 84.3 bits (207), Expect = 2.6e-13 Identity = 36/40 (90.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of Cla97C01G022520 vs. NCBI nr
Match: PNX79174.1 (B3 domain-containing protein, partial [Trifolium pratense]) HSP 1 Score: 84.3 bits (207), Expect = 2.6e-13 Identity = 38/45 (84.44%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of Cla97C01G022520 vs. NCBI nr
Match: XP_004485711.1 (PREDICTED: B3 domain-containing protein Os07g0563300-like [Cicer arietinum]) HSP 1 Score: 84.0 bits (206), Expect = 3.4e-13 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cla97C01G022520 vs. NCBI nr
Match: XP_007148240.1 (hypothetical protein PHAVU_006G191700g [Phaseolus vulgaris] >ESW20234.1 hypothetical protein PHAVU_006G191700g [Phaseolus vulgaris]) HSP 1 Score: 84.0 bits (206), Expect = 3.4e-13 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cla97C01G022520 vs. TrEMBL
Match: tr|A0A2K3LKV0|A0A2K3LKV0_TRIPR (B3 domain-containing protein (Fragment) OS=Trifolium pratense OX=57577 GN=L195_g035158 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.7e-13 Identity = 38/45 (84.44%), Postives = 39/45 (86.67%), Query Frame = 0
BLAST of Cla97C01G022520 vs. TrEMBL
Match: tr|A0A0B2QHJ5|A0A0B2QHJ5_GLYSO (F-box protein SKIP22 OS=Glycine soja OX=3848 GN=glysoja_047251 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.7e-13 Identity = 36/40 (90.00%), Postives = 37/40 (92.50%), Query Frame = 0
BLAST of Cla97C01G022520 vs. TrEMBL
Match: tr|I1M2C3|I1M2C3_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100782114 PE=4 SV=2) HSP 1 Score: 84.0 bits (206), Expect = 2.2e-13 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cla97C01G022520 vs. TrEMBL
Match: tr|I1MEA8|I1MEA8_SOYBN (Uncharacterized protein OS=Glycine max OX=3847 GN=100807252 PE=4 SV=2) HSP 1 Score: 84.0 bits (206), Expect = 2.2e-13 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cla97C01G022520 vs. TrEMBL
Match: tr|G7ILC5|G7ILC5_MEDTR (AP2/B3 transcription factor family protein OS=Medicago truncatula OX=3880 GN=11434350 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 2.2e-13 Identity = 36/39 (92.31%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cla97C01G022520 vs. Swiss-Prot
Match: sp|Q5CCK4|VAL2_ARATH (B3 domain-containing transcription repressor VAL2 OS=Arabidopsis thaliana OX=3702 GN=VAL2 PE=1 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.4e-15 Identity = 35/39 (89.74%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cla97C01G022520 vs. Swiss-Prot
Match: sp|Q0D5G4|Y7633_ORYSJ (B3 domain-containing protein Os07g0563300 OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0563300 PE=3 SV=2) HSP 1 Score: 81.6 bits (200), Expect = 5.4e-15 Identity = 34/38 (89.47%), Postives = 36/38 (94.74%), Query Frame = 0
BLAST of Cla97C01G022520 vs. Swiss-Prot
Match: sp|Q6Z3U3|Y7797_ORYSJ (B3 domain-containing protein Os07g0679700 OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0679700 PE=2 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.6e-14 Identity = 34/39 (87.18%), Postives = 36/39 (92.31%), Query Frame = 0
BLAST of Cla97C01G022520 vs. Swiss-Prot
Match: sp|Q8W4L5|VAL1_ARATH (B3 domain-containing transcription repressor VAL1 OS=Arabidopsis thaliana OX=3702 GN=VAL1 PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.8e-13 Identity = 31/39 (79.49%), Postives = 35/39 (89.74%), Query Frame = 0
BLAST of Cla97C01G022520 vs. Swiss-Prot
Match: sp|O65420|VAL3_ARATH (B3 domain-containing transcription factor VAL3 OS=Arabidopsis thaliana OX=3702 GN=VAL3 PE=4 SV=3) HSP 1 Score: 64.3 bits (155), Expect = 9.0e-10 Identity = 32/54 (59.26%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of Cla97C01G022520 vs. TAIR10
Match: AT4G32010.1 (HSI2-like 1) HSP 1 Score: 83.6 bits (205), Expect = 7.9e-17 Identity = 35/39 (89.74%), Postives = 37/39 (94.87%), Query Frame = 0
BLAST of Cla97C01G022520 vs. TAIR10
Match: AT2G30470.1 (high-level expression of sugar-inducible gene 2) HSP 1 Score: 76.6 bits (187), Expect = 9.7e-15 Identity = 31/39 (79.49%), Postives = 35/39 (89.74%), Query Frame = 0
BLAST of Cla97C01G022520 vs. TAIR10
Match: AT4G21550.1 (VP1/ABI3-like 3) HSP 1 Score: 64.3 bits (155), Expect = 5.0e-11 Identity = 32/54 (59.26%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of Cla97C01G022520 vs. TAIR10
Match: AT3G26790.1 (AP2/B3-like transcriptional factor family protein) HSP 1 Score: 43.1 bits (100), Expect = 1.2e-04 Identity = 16/34 (47.06%), Postives = 22/34 (64.71%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |