Cla97C01G014280 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTTGAGATAGTCGCCCCGGGACAAAACGATGCCTTGCTCCAAAACCGGTGCGAGCCAGGCGGTTGGGAACCGATCGAGAACATCCACGACTCGTACGTGCAAGAGATAGGAAGGTTTGCAGTGATGGAACACACACACAAGCTAGTAGGAGCATCACTGAGGTTCATTCGTGTGGTGAGTGGTGAGACTAGGCCGATGAGCGAAGGCAAAGAATACAGGCTTGTGGTGGAAGTGGCAGAACAGATAATAACTAGTCCTCCAATGTTATCAGTTTCTATCAAGTTTTACTTGGCAACTGTTCTGGAGAAGCCATTAGATCGATCTTGGACACTCAAAGCTTTTGTGCCTTGTAATTAG ATGGAATTTGAGATAGTCGCCCCGGGACAAAACGATGCCTTGCTCCAAAACCGGTGCGAGCCAGGCGGTTGGGAACCGATCGAGAACATCCACGACTCGTACGTGCAAGAGATAGGAAGGTTTGCAGTGATGGAACACACACACAAGCTAGTAGGAGCATCACTGAGGTTCATTCGTGTGGTGAGTGGTGAGACTAGGCCGATGAGCGAAGGCAAAGAATACAGGCTTGTGGTGGAAGTGGCAGAACAGATAATAACTAGTCCTCCAATGTTATCAGTTTCTATCAAGTTTTACTTGGCAACTGTTCTGGAGAAGCCATTAGATCGATCTTGGACACTCAAAGCTTTTGTGCCTTGTAATTAG ATGGAATTTGAGATAGTCGCCCCGGGACAAAACGATGCCTTGCTCCAAAACCGGTGCGAGCCAGGCGGTTGGGAACCGATCGAGAACATCCACGACTCGTACGTGCAAGAGATAGGAAGGTTTGCAGTGATGGAACACACACACAAGCTAGTAGGAGCATCACTGAGGTTCATTCGTGTGGTGAGTGGTGAGACTAGGCCGATGAGCGAAGGCAAAGAATACAGGCTTGTGGTGGAAGTGGCAGAACAGATAATAACTAGTCCTCCAATGTTATCAGTTTCTATCAAGTTTTACTTGGCAACTGTTCTGGAGAAGCCATTAGATCGATCTTGGACACTCAAAGCTTTTGTGCCTTGTAATTAG MEFEIVAPGQNDALLQNRCEPGGWEPIENIHDSYVQEIGRFAVMEHTHKLVGASLRFIRVVSGETRPMSEGKEYRLVVEVAEQIITSPPMLSVSIKFYLATVLEKPLDRSWTLKAFVPCN
BLAST of Cla97C01G014280 vs. NCBI nr
Match: XP_022132557.1 (cysteine proteinase inhibitor 6-like [Momordica charantia]) HSP 1 Score: 130.6 bits (327), Expect = 3.6e-27 Identity = 71/116 (61.21%), Postives = 87/116 (75.00%), Query Frame = 0
BLAST of Cla97C01G014280 vs. NCBI nr
Match: XP_023543511.1 (cysteine proteinase inhibitor 5-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 120.2 bits (300), Expect = 4.9e-24 Identity = 62/118 (52.54%), Postives = 83/118 (70.34%), Query Frame = 0
BLAST of Cla97C01G014280 vs. NCBI nr
Match: XP_022132703.1 (cysteine proteinase inhibitor 5-like [Momordica charantia]) HSP 1 Score: 116.7 bits (291), Expect = 5.4e-23 Identity = 69/122 (56.56%), Postives = 87/122 (71.31%), Query Frame = 0
BLAST of Cla97C01G014280 vs. NCBI nr
Match: XP_022132702.1 (cysteine proteinase inhibitor 5-like [Momordica charantia]) HSP 1 Score: 116.3 bits (290), Expect = 7.1e-23 Identity = 68/122 (55.74%), Postives = 85/122 (69.67%), Query Frame = 0
BLAST of Cla97C01G014280 vs. NCBI nr
Match: XP_022949716.1 (uncharacterized protein LOC111453027 [Cucurbita moschata]) HSP 1 Score: 116.3 bits (290), Expect = 7.1e-23 Identity = 62/118 (52.54%), Postives = 81/118 (68.64%), Query Frame = 0
BLAST of Cla97C01G014280 vs. TrEMBL
Match: tr|A0A2I0W4K2|A0A2I0W4K2_9ASPA (Cysteine proteinase inhibitor OS=Dendrobium catenatum OX=906689 GN=CYS5 PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 6.0e-10 Identity = 43/96 (44.79%), Postives = 68/96 (70.83%), Query Frame = 0
BLAST of Cla97C01G014280 vs. TrEMBL
Match: tr|A0A1D1YNQ2|A0A1D1YNQ2_9ARAE (Cysteine proteinase inhibitor (Fragment) OS=Anthurium amnicola OX=1678845 GN=CYS5 PE=3 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 1.7e-09 Identity = 41/97 (42.27%), Postives = 62/97 (63.92%), Query Frame = 0
BLAST of Cla97C01G014280 vs. TrEMBL
Match: tr|A0A2I4G446|A0A2I4G446_9ROSI (Cysteine proteinase inhibitor OS=Juglans regia OX=51240 GN=LOC109004561 PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 1.5e-08 Identity = 43/97 (44.33%), Postives = 57/97 (58.76%), Query Frame = 0
BLAST of Cla97C01G014280 vs. TrEMBL
Match: tr|V4NY46|V4NY46_EUTSA (Cysteine proteinase inhibitor OS=Eutrema salsugineum OX=72664 GN=EUTSA_v10017424mg PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 1.5e-08 Identity = 41/98 (41.84%), Postives = 58/98 (59.18%), Query Frame = 0
BLAST of Cla97C01G014280 vs. TrEMBL
Match: tr|M8AR43|M8AR43_TRIUA (Cysteine proteinase inhibitor OS=Triticum urartu OX=4572 GN=TRIUR3_30234 PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 1.2e-07 Identity = 38/102 (37.25%), Postives = 56/102 (54.90%), Query Frame = 0
BLAST of Cla97C01G014280 vs. Swiss-Prot
Match: sp|Q41916|CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 60.1 bits (144), Expect = 2.0e-08 Identity = 42/99 (42.42%), Postives = 53/99 (53.54%), Query Frame = 0
BLAST of Cla97C01G014280 vs. Swiss-Prot
Match: sp|Q10J94|CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 6.4e-07 Identity = 37/97 (38.14%), Postives = 52/97 (53.61%), Query Frame = 0
BLAST of Cla97C01G014280 vs. Swiss-Prot
Match: sp|Q10Q46|CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 8.3e-07 Identity = 27/61 (44.26%), Postives = 37/61 (60.66%), Query Frame = 0
BLAST of Cla97C01G014280 vs. Swiss-Prot
Match: sp|Q10Q47|CYT7_ORYSJ (Putative cysteine proteinase inhibitor 7 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210100 PE=3 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 6.0e-05 Identity = 25/60 (41.67%), Postives = 37/60 (61.67%), Query Frame = 0
BLAST of Cla97C01G014280 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 60.1 bits (144), Expect = 1.1e-09 Identity = 42/99 (42.42%), Postives = 53/99 (53.54%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|