Cla97C01G012050 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCATTTACTCTCTCCCTCGCCAACTTTTGCAATGGTGTTATATGGGCCATTTACGCTATTCTCAAATTCGATCCTAATGTCTTGGTAAGCTTACAACGATCTCATAAGGCCTCATTTGATAACCATTTGATTTTTTGTTTTAGAATATTGTTTAAGTGCCCTTTTTTTTGCAACTTTGTTGCCATAATTTTTCAGTTTTCTAATTAAACATTTGAATCCTTAGCTAAGTTTATATATATATATATATAGTATTCTAGAAAATCAAATAATTATTAAACTAGCCTAAACTTTTCGATTAAATAAAAATCCATCAAATCATGTATAATAAACTTTTTGGTTTAATTGTAAATTTATATAGAGTTTCATTTTGTTCTTATTTTTTGTTTTTTTTATTTTATTATTATTTTTTTTCAGATTCCAAACAGTTTGGGTGCTCTTTCTGGGTTGATACAATTAAGTTTGTATGCAACTTACTACAAAACCACAAATTGGGACAGTGACGACATGTTGAACTCTAAGAGACCAATAGAGGTGCAAATGTCCGACGTGTAG ATGTCATTTACTCTCTCCCTCGCCAACTTTTGCAATGGTGTTATATGGGCCATTTACGCTATTCTCAAATTCGATCCTAATGTCTTGATTCCAAACAGTTTGGGTGCTCTTTCTGGGTTGATACAATTAAGTTTGTATGCAACTTACTACAAAACCACAAATTGGGACAGTGACGACATGTTGAACTCTAAGAGACCAATAGAGGTGCAAATGTCCGACGTGTAG ATGTCATTTACTCTCTCCCTCGCCAACTTTTGCAATGGTGTTATATGGGCCATTTACGCTATTCTCAAATTCGATCCTAATGTCTTGATTCCAAACAGTTTGGGTGCTCTTTCTGGGTTGATACAATTAAGTTTGTATGCAACTTACTACAAAACCACAAATTGGGACAGTGACGACATGTTGAACTCTAAGAGACCAATAGAGGTGCAAATGTCCGACGTGTAG MSFTLSLANFCNGVIWAIYAILKFDPNVLIPNSLGALSGLIQLSLYATYYKTTNWDSDDMLNSKRPIEVQMSDV
BLAST of Cla97C01G012050 vs. NCBI nr
Match: XP_004152552.1 (PREDICTED: bidirectional sugar transporter SWEET5 [Cucumis sativus] >KGN64303.1 hypothetical protein Csa_1G046010 [Cucumis sativus]) HSP 1 Score: 131.7 bits (330), Expect = 1.0e-27 Identity = 64/73 (87.67%), Postives = 67/73 (91.78%), Query Frame = 0
BLAST of Cla97C01G012050 vs. NCBI nr
Match: XP_022924129.1 (bidirectional sugar transporter SWEET5 [Cucurbita moschata]) HSP 1 Score: 126.3 bits (316), Expect = 4.2e-26 Identity = 61/74 (82.43%), Postives = 67/74 (90.54%), Query Frame = 0
BLAST of Cla97C01G012050 vs. NCBI nr
Match: XP_023520311.1 (bidirectional sugar transporter SWEET5-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 126.3 bits (316), Expect = 4.2e-26 Identity = 61/74 (82.43%), Postives = 67/74 (90.54%), Query Frame = 0
BLAST of Cla97C01G012050 vs. NCBI nr
Match: XP_023000664.1 (bidirectional sugar transporter SWEET5-like [Cucurbita maxima]) HSP 1 Score: 124.8 bits (312), Expect = 1.2e-25 Identity = 60/74 (81.08%), Postives = 67/74 (90.54%), Query Frame = 0
BLAST of Cla97C01G012050 vs. NCBI nr
Match: XP_008438271.1 (PREDICTED: bidirectional sugar transporter SWEET5 [Cucumis melo]) HSP 1 Score: 124.4 bits (311), Expect = 1.6e-25 Identity = 59/73 (80.82%), Postives = 65/73 (89.04%), Query Frame = 0
BLAST of Cla97C01G012050 vs. TrEMBL
Match: tr|A0A0A0LR77|A0A0A0LR77_CUCSA (Bidirectional sugar transporter SWEET OS=Cucumis sativus OX=3659 GN=Csa_1G046010 PE=3 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 6.7e-28 Identity = 64/73 (87.67%), Postives = 67/73 (91.78%), Query Frame = 0
BLAST of Cla97C01G012050 vs. TrEMBL
Match: tr|A0A1S3AVN4|A0A1S3AVN4_CUCME (Bidirectional sugar transporter SWEET OS=Cucumis melo OX=3656 GN=LOC103483429 PE=3 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 1.1e-25 Identity = 59/73 (80.82%), Postives = 65/73 (89.04%), Query Frame = 0
BLAST of Cla97C01G012050 vs. TrEMBL
Match: tr|M5VGY3|M5VGY3_PRUPE (Bidirectional sugar transporter SWEET OS=Prunus persica OX=3760 GN=PRUPE_8G076100 PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 9.3e-22 Identity = 50/74 (67.57%), Postives = 61/74 (82.43%), Query Frame = 0
BLAST of Cla97C01G012050 vs. TrEMBL
Match: tr|A0A2P5F6F3|A0A2P5F6F3_9ROSA (Bidirectional sugar transporter SWEET OS=Trema orientalis OX=63057 GN=TorRG33x02_109430 PE=3 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 2.1e-21 Identity = 52/74 (70.27%), Postives = 61/74 (82.43%), Query Frame = 0
BLAST of Cla97C01G012050 vs. TrEMBL
Match: tr|A0A2P5CJ77|A0A2P5CJ77_PARAD (Bidirectional sugar transporter SWEET OS=Parasponia andersonii OX=3476 GN=PanWU01x14_148870 PE=3 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 2.1e-21 Identity = 52/74 (70.27%), Postives = 61/74 (82.43%), Query Frame = 0
BLAST of Cla97C01G012050 vs. Swiss-Prot
Match: sp|Q9FM10|SWET5_ARATH (Bidirectional sugar transporter SWEET5 OS=Arabidopsis thaliana OX=3702 GN=SWEET5 PE=1 SV=2) HSP 1 Score: 98.2 bits (243), Expect = 4.0e-20 Identity = 45/65 (69.23%), Postives = 51/65 (78.46%), Query Frame = 0
BLAST of Cla97C01G012050 vs. Swiss-Prot
Match: sp|Q944M5|SWET4_ARATH (Bidirectional sugar transporter SWEET4 OS=Arabidopsis thaliana OX=3702 GN=SWEET4 PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.6e-13 Identity = 35/53 (66.04%), Postives = 42/53 (79.25%), Query Frame = 0
BLAST of Cla97C01G012050 vs. Swiss-Prot
Match: sp|A2WSD3|SWT6B_ORYSI (Bidirectional sugar transporter SWEET6b OS=Oryza sativa subsp. indica OX=39946 GN=SWEET6B PE=3 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 4.5e-11 Identity = 33/53 (62.26%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of Cla97C01G012050 vs. Swiss-Prot
Match: sp|A2WSD8|SWT6A_ORYSI (Bidirectional sugar transporter SWEET6a OS=Oryza sativa subsp. indica OX=39946 GN=SWEET6A PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 7.6e-11 Identity = 33/53 (62.26%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of Cla97C01G012050 vs. Swiss-Prot
Match: sp|Q8LR09|SWT6A_ORYSJ (Bidirectional sugar transporter SWEET6a OS=Oryza sativa subsp. japonica OX=39947 GN=SWEET6A PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 7.6e-11 Identity = 33/53 (62.26%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of Cla97C01G012050 vs. TAIR10
Match: AT5G62850.1 (Nodulin MtN3 family protein) HSP 1 Score: 98.2 bits (243), Expect = 2.2e-21 Identity = 45/65 (69.23%), Postives = 51/65 (78.46%), Query Frame = 0
BLAST of Cla97C01G012050 vs. TAIR10
Match: AT3G28007.1 (Nodulin MtN3 family protein) HSP 1 Score: 76.3 bits (186), Expect = 9.1e-15 Identity = 35/53 (66.04%), Postives = 42/53 (79.25%), Query Frame = 0
BLAST of Cla97C01G012050 vs. TAIR10
Match: AT4G10850.1 (Nodulin MtN3 family protein) HSP 1 Score: 64.7 bits (156), Expect = 2.7e-11 Identity = 29/53 (54.72%), Postives = 36/53 (67.92%), Query Frame = 0
BLAST of Cla97C01G012050 vs. TAIR10
Match: AT1G66770.1 (Nodulin MtN3 family protein) HSP 1 Score: 63.5 bits (153), Expect = 6.1e-11 Identity = 28/62 (45.16%), Postives = 38/62 (61.29%), Query Frame = 0
BLAST of Cla97C01G012050 vs. TAIR10
Match: AT4G15920.1 (Nodulin MtN3 family protein) HSP 1 Score: 52.0 bits (123), Expect = 1.8e-07 Identity = 24/49 (48.98%), Postives = 32/49 (65.31%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |