Cla97C01G010330 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGTTGATCACAGTGACAAGTTCACAGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGATGATCCACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACAACCTTCAATTAACGGCTCTTGAGGGGATTGTAAGCAAAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTATCCAACTAA ATGTTGTTGATCACAGTGACAAGTTCACAGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGATGATCCACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACAACCTTCAATTAACGGCTCTTGAGGGGATTGTAAGCAAAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTATCCAACTAA ATGTTGTTGATCACAGTGACAAGTTCACAGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGATGATCCACATATCCAAAGCCTAGGAGAATTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGATTAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACAACCTTCAATTAACGGCTCTTGAGGGGATTGTAAGCAAAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTATCCAACTAA MLLITVTSSQLDLVGGYEPIKNIDDPHIQSLGEFAVNEHNKQAKTQLKFEKVISGKLQIVAGTNYNLQLTALEGIVSKTYGTLVFTDLKNENHLINFYDLSN
BLAST of Cla97C01G010330 vs. NCBI nr
Match: XP_022927105.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 156.8 bits (395), Expect = 4.0e-35 Identity = 76/98 (77.55%), Postives = 86/98 (87.76%), Query Frame = 0
BLAST of Cla97C01G010330 vs. NCBI nr
Match: XP_022975330.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 156.4 bits (394), Expect = 5.3e-35 Identity = 75/99 (75.76%), Postives = 89/99 (89.90%), Query Frame = 0
BLAST of Cla97C01G010330 vs. NCBI nr
Match: XP_022975673.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 155.6 bits (392), Expect = 9.0e-35 Identity = 75/99 (75.76%), Postives = 89/99 (89.90%), Query Frame = 0
BLAST of Cla97C01G010330 vs. NCBI nr
Match: XP_004151251.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus] >KGN65046.1 hypothetical protein Csa_1G183070 [Cucumis sativus]) HSP 1 Score: 155.2 bits (391), Expect = 1.2e-34 Identity = 76/102 (74.51%), Postives = 90/102 (88.24%), Query Frame = 0
BLAST of Cla97C01G010330 vs. NCBI nr
Match: XP_022975293.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 154.8 bits (390), Expect = 1.5e-34 Identity = 73/98 (74.49%), Postives = 88/98 (89.80%), Query Frame = 0
BLAST of Cla97C01G010330 vs. TrEMBL
Match: tr|A0A0A0LYM0|A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 7.8e-35 Identity = 76/102 (74.51%), Postives = 90/102 (88.24%), Query Frame = 0
BLAST of Cla97C01G010330 vs. TrEMBL
Match: tr|A0A0A0LT34|A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 1.2e-32 Identity = 76/103 (73.79%), Postives = 88/103 (85.44%), Query Frame = 0
BLAST of Cla97C01G010330 vs. TrEMBL
Match: tr|A0A2G5D4B6|A0A2G5D4B6_AQUCA (Cysteine proteinase inhibitor OS=Aquilegia coerulea OX=218851 GN=AQUCO_02800208v1 PE=3 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 1.2e-16 Identity = 44/73 (60.27%), Postives = 57/73 (78.08%), Query Frame = 0
BLAST of Cla97C01G010330 vs. TrEMBL
Match: tr|A0A1Q3BBP5|A0A1Q3BBP5_CEPFO (Cysteine proteinase inhibitor OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_08747 PE=3 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 8.1e-16 Identity = 42/73 (57.53%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of Cla97C01G010330 vs. TrEMBL
Match: tr|A0A2P4JTN5|A0A2P4JTN5_QUESU (Cysteine proteinase inhibitor OS=Quercus suber OX=58331 GN=CFP56_45185 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 1.1e-15 Identity = 39/79 (49.37%), Postives = 60/79 (75.95%), Query Frame = 0
BLAST of Cla97C01G010330 vs. Swiss-Prot
Match: sp|Q41916|CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 80.9 bits (198), Expect = 9.2e-15 Identity = 39/86 (45.35%), Postives = 63/86 (73.26%), Query Frame = 0
BLAST of Cla97C01G010330 vs. Swiss-Prot
Match: sp|Q10Q46|CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.9e-12 Identity = 41/100 (41.00%), Postives = 62/100 (62.00%), Query Frame = 0
BLAST of Cla97C01G010330 vs. Swiss-Prot
Match: sp|Q6TPK4|CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 5.6e-12 Identity = 32/80 (40.00%), Postives = 52/80 (65.00%), Query Frame = 0
BLAST of Cla97C01G010330 vs. Swiss-Prot
Match: sp|P09229|CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 67.4 bits (163), Expect = 1.1e-10 Identity = 33/73 (45.21%), Postives = 46/73 (63.01%), Query Frame = 0
BLAST of Cla97C01G010330 vs. Swiss-Prot
Match: sp|Q84WT8|CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 66.2 bits (160), Expect = 2.3e-10 Identity = 26/61 (42.62%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of Cla97C01G010330 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 80.9 bits (198), Expect = 5.1e-16 Identity = 39/86 (45.35%), Postives = 63/86 (73.26%), Query Frame = 0
BLAST of Cla97C01G010330 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 66.2 bits (160), Expect = 1.3e-11 Identity = 26/61 (42.62%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of Cla97C01G010330 vs. TAIR10
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 57.4 bits (137), Expect = 6.0e-09 Identity = 29/74 (39.19%), Postives = 46/74 (62.16%), Query Frame = 0
BLAST of Cla97C01G010330 vs. TAIR10
Match: AT5G12140.1 (cystatin-1) HSP 1 Score: 55.5 bits (132), Expect = 2.3e-08 Identity = 31/90 (34.44%), Postives = 50/90 (55.56%), Query Frame = 0
BLAST of Cla97C01G010330 vs. TAIR10
Match: AT3G12490.2 (cystatin B) HSP 1 Score: 54.3 bits (129), Expect = 5.1e-08 Identity = 30/79 (37.97%), Postives = 46/79 (58.23%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |