Cla97C01G010320 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGTCGGTCACAGCGACAAGTTCACGGTTAGAGTTGGTCGGTGGCTATGAACCAATAAAGAACATAGAGGATCAACATATCCAAAGCCTAGGAGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAACAGTGATTAGTGGAAAATTACAAATTGTGGCTGGGACCAACTACGGCCTTCAATTAACAGCTCTTGAGGGGAATGTAAGCAGAATCTATGGAACCCTTATATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTCTCCAACTAA ATGTTGTCGGTCACAGCGACAAGTTCACGGTTAGAGTTGGTCGGTGGCTATGAACCAATAAAGAACATAGAGGATCAACATATCCAAAGCCTAGGAGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAACAGTGATTAGTGGAAAATTACAAATTGTGGCTGGGACCAACTACGGCCTTCAATTAACAGCTCTTGAGGGGAATGTAAGCAGAATCTATGGAACCCTTATATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTCTCCAACTAA ATGTTGTCGGTCACAGCGACAAGTTCACGGTTAGAGTTGGTCGGTGGCTATGAACCAATAAAGAACATAGAGGATCAACATATCCAAAGCCTAGGAGAGTTCGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAACAGTGATTAGTGGAAAATTACAAATTGTGGCTGGGACCAACTACGGCCTTCAATTAACAGCTCTTGAGGGGAATGTAAGCAGAATCTATGGAACCCTTATATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGACCTCTCCAACTAA MLSVTATSSRLELVGGYEPIKNIEDQHIQSLGEFAVNEHNKQAKTQLKFETVISGKLQIVAGTNYGLQLTALEGNVSRIYGTLIFTDLKNENHLINFYDLSN
BLAST of Cla97C01G010320 vs. NCBI nr
Match: XP_004151251.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus] >KGN65046.1 hypothetical protein Csa_1G183070 [Cucumis sativus]) HSP 1 Score: 149.4 bits (376), Expect = 6.4e-33 Identity = 74/102 (72.55%), Postives = 88/102 (86.27%), Query Frame = 0
BLAST of Cla97C01G010320 vs. NCBI nr
Match: XP_022927105.1 (cysteine proteinase inhibitor 1-like [Cucurbita moschata]) HSP 1 Score: 148.7 bits (374), Expect = 1.1e-32 Identity = 73/99 (73.74%), Postives = 85/99 (85.86%), Query Frame = 0
BLAST of Cla97C01G010320 vs. NCBI nr
Match: XP_004151250.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus] >KGN65045.1 hypothetical protein Csa_1G182070 [Cucumis sativus]) HSP 1 Score: 146.0 bits (367), Expect = 7.1e-32 Identity = 74/103 (71.84%), Postives = 88/103 (85.44%), Query Frame = 0
BLAST of Cla97C01G010320 vs. NCBI nr
Match: XP_022975330.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 145.2 bits (365), Expect = 1.2e-31 Identity = 70/100 (70.00%), Postives = 85/100 (85.00%), Query Frame = 0
BLAST of Cla97C01G010320 vs. NCBI nr
Match: XP_022975673.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 144.4 bits (363), Expect = 2.1e-31 Identity = 70/100 (70.00%), Postives = 85/100 (85.00%), Query Frame = 0
BLAST of Cla97C01G010320 vs. TrEMBL
Match: tr|A0A0A0LYM0|A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 4.3e-33 Identity = 74/102 (72.55%), Postives = 88/102 (86.27%), Query Frame = 0
BLAST of Cla97C01G010320 vs. TrEMBL
Match: tr|A0A0A0LT34|A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 4.7e-32 Identity = 74/103 (71.84%), Postives = 88/103 (85.44%), Query Frame = 0
BLAST of Cla97C01G010320 vs. TrEMBL
Match: tr|A0A2G5D4B6|A0A2G5D4B6_AQUCA (Cysteine proteinase inhibitor OS=Aquilegia coerulea OX=218851 GN=AQUCO_02800208v1 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 1.4e-15 Identity = 43/73 (58.90%), Postives = 56/73 (76.71%), Query Frame = 0
BLAST of Cla97C01G010320 vs. TrEMBL
Match: tr|A0A1Q3BBP5|A0A1Q3BBP5_CEPFO (Cysteine proteinase inhibitor OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_08747 PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 8.9e-15 Identity = 44/86 (51.16%), Postives = 61/86 (70.93%), Query Frame = 0
BLAST of Cla97C01G010320 vs. TrEMBL
Match: tr|F6HRK8|F6HRK8_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera OX=29760 GN=VIT_00s0187g00040 PE=3 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 7.6e-14 Identity = 39/73 (53.42%), Postives = 53/73 (72.60%), Query Frame = 0
BLAST of Cla97C01G010320 vs. Swiss-Prot
Match: sp|Q41916|CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 76.3 bits (186), Expect = 2.3e-13 Identity = 35/73 (47.95%), Postives = 57/73 (78.08%), Query Frame = 0
BLAST of Cla97C01G010320 vs. Swiss-Prot
Match: sp|Q6TPK4|CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.7e-11 Identity = 30/76 (39.47%), Postives = 51/76 (67.11%), Query Frame = 0
BLAST of Cla97C01G010320 vs. Swiss-Prot
Match: sp|Q10Q46|CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.1e-10 Identity = 38/100 (38.00%), Postives = 60/100 (60.00%), Query Frame = 0
BLAST of Cla97C01G010320 vs. Swiss-Prot
Match: sp|P09229|CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 4.0e-10 Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 0
BLAST of Cla97C01G010320 vs. Swiss-Prot
Match: sp|Q84WT8|CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 59.7 bits (143), Expect = 2.2e-08 Identity = 24/61 (39.34%), Postives = 42/61 (68.85%), Query Frame = 0
BLAST of Cla97C01G010320 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 76.3 bits (186), Expect = 1.3e-14 Identity = 35/73 (47.95%), Postives = 57/73 (78.08%), Query Frame = 0
BLAST of Cla97C01G010320 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 59.7 bits (143), Expect = 1.2e-09 Identity = 24/61 (39.34%), Postives = 42/61 (68.85%), Query Frame = 0
BLAST of Cla97C01G010320 vs. TAIR10
Match: AT5G12140.1 (cystatin-1) HSP 1 Score: 53.5 bits (127), Expect = 8.7e-08 Identity = 29/90 (32.22%), Postives = 48/90 (53.33%), Query Frame = 0
BLAST of Cla97C01G010320 vs. TAIR10
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 52.8 bits (125), Expect = 1.5e-07 Identity = 26/73 (35.62%), Postives = 44/73 (60.27%), Query Frame = 0
BLAST of Cla97C01G010320 vs. TAIR10
Match: AT3G12490.2 (cystatin B) HSP 1 Score: 52.0 bits (123), Expect = 2.5e-07 Identity = 28/74 (37.84%), Postives = 41/74 (55.41%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |