Cla97C01G010310 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGTCGGTCACAGTGACAAGTTCAAGGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGCTGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGAATAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACGACCTTCGATTAACAGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAATGGGAACCATCTTATCAACTTCTATGGCCTCTCCAACTAA ATGTTGTCGGTCACAGTGACAAGTTCAAGGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGCTGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGAATAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACGACCTTCGATTAACAGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAATGGGAACCATCTTATCAACTTCTATGGCCTCTCCAACTAA ATGTTGTCGGTCACAGTGACAAGTTCAAGGTTAGATTTGGTTGGTGGCTATGAACCAATAAAGAACATAGCTGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAAAAAGTGAATAGTGGAAAATTACAGATTGTGGCTGGGACCAACTACGACCTTCGATTAACAGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAATGGGAACCATCTTATCAACTTCTATGGCCTCTCCAACTAA MLSVTVTSSRLDLVGGYEPIKNIADPHIQSLGEFAVNEHNKQAKTQLKFEKVNSGKLQIVAGTNYDLRLTALEGTVSRTYGTLVFTDLKNGNHLINFYGLSN
BLAST of Cla97C01G010310 vs. NCBI nr
Match: XP_004151251.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus] >KGN65046.1 hypothetical protein Csa_1G183070 [Cucumis sativus]) HSP 1 Score: 164.9 bits (416), Expect = 1.5e-37 Identity = 82/102 (80.39%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of Cla97C01G010310 vs. NCBI nr
Match: XP_022975673.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 157.5 bits (397), Expect = 2.4e-35 Identity = 78/100 (78.00%), Postives = 89/100 (89.00%), Query Frame = 0
BLAST of Cla97C01G010310 vs. NCBI nr
Match: XP_022975330.1 (cysteine proteinase inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 152.9 bits (385), Expect = 5.8e-34 Identity = 76/100 (76.00%), Postives = 87/100 (87.00%), Query Frame = 0
BLAST of Cla97C01G010310 vs. NCBI nr
Match: XP_023520236.1 (cysteine proteinase inhibitor 5-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 152.1 bits (383), Expect = 9.9e-34 Identity = 74/100 (74.00%), Postives = 87/100 (87.00%), Query Frame = 0
BLAST of Cla97C01G010310 vs. NCBI nr
Match: XP_023520844.1 (cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 151.4 bits (381), Expect = 1.7e-33 Identity = 74/100 (74.00%), Postives = 87/100 (87.00%), Query Frame = 0
BLAST of Cla97C01G010310 vs. TrEMBL
Match: tr|A0A0A0LYM0|A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 9.8e-38 Identity = 82/102 (80.39%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of Cla97C01G010310 vs. TrEMBL
Match: tr|A0A0A0LT34|A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 2.1e-32 Identity = 74/103 (71.84%), Postives = 89/103 (86.41%), Query Frame = 0
BLAST of Cla97C01G010310 vs. TrEMBL
Match: tr|A0A2G5D4B6|A0A2G5D4B6_AQUCA (Cysteine proteinase inhibitor OS=Aquilegia coerulea OX=218851 GN=AQUCO_02800208v1 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 5.6e-17 Identity = 45/73 (61.64%), Postives = 56/73 (76.71%), Query Frame = 0
BLAST of Cla97C01G010310 vs. TrEMBL
Match: tr|A0A1Q3BBP5|A0A1Q3BBP5_CEPFO (Cysteine proteinase inhibitor OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_08747 PE=3 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 8.1e-16 Identity = 45/86 (52.33%), Postives = 61/86 (70.93%), Query Frame = 0
BLAST of Cla97C01G010310 vs. TrEMBL
Match: tr|A0A2P4JTN5|A0A2P4JTN5_QUESU (Cysteine proteinase inhibitor OS=Quercus suber OX=58331 GN=CFP56_45185 PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 2.0e-14 Identity = 38/78 (48.72%), Postives = 58/78 (74.36%), Query Frame = 0
BLAST of Cla97C01G010310 vs. Swiss-Prot
Match: sp|Q41916|CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 77.0 bits (188), Expect = 1.3e-13 Identity = 36/73 (49.32%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of Cla97C01G010310 vs. Swiss-Prot
Match: sp|Q6TPK4|CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.7e-11 Identity = 35/85 (41.18%), Postives = 52/85 (61.18%), Query Frame = 0
BLAST of Cla97C01G010310 vs. Swiss-Prot
Match: sp|Q10Q46|CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 8.1e-11 Identity = 37/86 (43.02%), Postives = 55/86 (63.95%), Query Frame = 0
BLAST of Cla97C01G010310 vs. Swiss-Prot
Match: sp|Q84WT8|CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 66.6 bits (161), Expect = 1.8e-10 Identity = 27/61 (44.26%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of Cla97C01G010310 vs. Swiss-Prot
Match: sp|P09229|CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 2.0e-09 Identity = 32/73 (43.84%), Postives = 44/73 (60.27%), Query Frame = 0
BLAST of Cla97C01G010310 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 77.0 bits (188), Expect = 7.4e-15 Identity = 36/73 (49.32%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of Cla97C01G010310 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 66.6 bits (161), Expect = 1.0e-11 Identity = 27/61 (44.26%), Postives = 45/61 (73.77%), Query Frame = 0
BLAST of Cla97C01G010310 vs. TAIR10
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 52.8 bits (125), Expect = 1.5e-07 Identity = 28/74 (37.84%), Postives = 43/74 (58.11%), Query Frame = 0
BLAST of Cla97C01G010310 vs. TAIR10
Match: AT5G12140.1 (cystatin-1) HSP 1 Score: 51.6 bits (122), Expect = 3.3e-07 Identity = 30/90 (33.33%), Postives = 47/90 (52.22%), Query Frame = 0
BLAST of Cla97C01G010310 vs. TAIR10
Match: AT3G12490.2 (cystatin B) HSP 1 Score: 48.9 bits (115), Expect = 2.1e-06 Identity = 29/79 (36.71%), Postives = 42/79 (53.16%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |