Cla97C01G003080 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAATGGCGAAGACCCTGGACGTGGCCATTGTGGAGGTCTCCTCGAATGTCAAGGTTATTAACTCACCACGTTTAAATTTTAAAAAGCTTAAGTTTATAGGTTAAACAGTATATAGTAAACGAATTTATTCATATTCTTAACAGGCCGTTACGCTGCTCCGCCTAACACCCTTGCGGAATATGCATTAAACCAATACAACAACTTGGACTTCTTGGATATCTCTCTTCCGGTGCAGTGCAGACATCAACGGACAATGCCCGAACCAGCTAAGGCCTCCGGGAGGCTGCAACAACCCGTACCGTGTTCAAAACCAACGAGTACTGCTGCAACTCCGGCAATTGTGGGCCGACTCCTTTTTCTAAGTTCTTCAAGGATCGGTGCCTTGATGCATACAGTTATCCCAAAGATGATGATCAAACTAGCACCTTCACTTGCCCTGGTGGAACCAACTATAGGGGTTGTCTTCTGCCCTTAG ATGGAAATGGCGAAGACCCTGGACGTGGCCATTGTGGAGGTCTCCTCGAATGTCAAGGTTATTAACTCACCACGCCGTTACGCTGCTCCGCCTAACACCCTTGCGGAATATGCATTAAACCAATACAACAACTTGGACTTCTTGGATATCTCTCTTCCGGTGCAGTGCAGACATCAACGGACAATGCCCGAACCAGCTAAGGCCTCCGGGAGGCTGCAACAACCCGTACCGTGTTCAAAACCAACGAGTACTGCTGCAACTCCGGCAATTGTGGGCCGACTCCTTTTTCTAAGTTCTTCAAGGATCGGTGCCTTGATGCATACAGTTATCCCAAAGATGATGATCAAACTAGCACCTTCACTTGCCCTGGTGGAACCAACTATAGGGGTTGTCTTCTGCCCTTAG ATGGAAATGGCGAAGACCCTGGACGTGGCCATTGTGGAGGTCTCCTCGAATGTCAAGGTTATTAACTCACCACGCCGTTACGCTGCTCCGCCTAACACCCTTGCGGAATATGCATTAAACCAATACAACAACTTGGACTTCTTGGATATCTCTCTTCCGGTGCAGTGCAGACATCAACGGACAATGCCCGAACCAGCTAAGGCCTCCGGGAGGCTGCAACAACCCGTACCGTGTTCAAAACCAACGAGTACTGCTGCAACTCCGGCAATTGTGGGCCGACTCCTTTTTCTAAGTTCTTCAAGGATCGGTGCCTTGATGCATACAGTTATCCCAAAGATGATGATCAAACTAGCACCTTCACTTGCCCTGGTGGAACCAACTATAGGGGTTGTCTTCTGCCCTTAG MEMAKTLDVAIVEVSSNVKVINSPRRYAAPPNTLAEYALNQYNNLDFLDISLPVQCRHQRTMPEPAKASGRLQQPVPCSKPTSTAATPAIVGRLLFLSSSRIGALMHTVIPKMMIKLAPSLALVEPTIGVVFCP
BLAST of Cla97C01G003080 vs. NCBI nr
Match: PNS23055.1 (hypothetical protein POPTR_T094200v3 [Populus trichocarpa]) HSP 1 Score: 58.2 bits (139), Expect = 2.6e-05 Identity = 50/124 (40.32%), Postives = 56/124 (45.16%), Query Frame = 0
BLAST of Cla97C01G003080 vs. NCBI nr
Match: XP_012836299.1 (PREDICTED: thaumatin-like protein [Erythranthe guttata] >EYU38379.1 hypothetical protein MIMGU_mgv1a013131mg [Erythranthe guttata]) HSP 1 Score: 54.7 bits (130), Expect = 2.8e-04 Identity = 34/75 (45.33%), Postives = 41/75 (54.67%), Query Frame = 0
BLAST of Cla97C01G003080 vs. NCBI nr
Match: XP_024993848.1 (thaumatin-like protein [Cynara cardunculus var. scolymus] >KVH95151.1 Thaumatin [Cynara cardunculus var. scolymus]) HSP 1 Score: 54.3 bits (129), Expect = 3.7e-04 Identity = 24/26 (92.31%), Postives = 24/26 (92.31%), Query Frame = 0
BLAST of Cla97C01G003080 vs. NCBI nr
Match: XP_022881237.1 (thaumatin-like protein [Olea europaea var. sylvestris]) HSP 1 Score: 54.3 bits (129), Expect = 3.7e-04 Identity = 24/26 (92.31%), Postives = 24/26 (92.31%), Query Frame = 0
BLAST of Cla97C01G003080 vs. NCBI nr
Match: XP_020217848.1 (protein P21-like isoform X1 [Cajanus cajan] >XP_020217849.1 protein P21-like isoform X2 [Cajanus cajan]) HSP 1 Score: 53.5 bits (127), Expect = 6.3e-04 Identity = 23/28 (82.14%), Postives = 24/28 (85.71%), Query Frame = 0
BLAST of Cla97C01G003080 vs. TrEMBL
Match: tr|A0A2K1R6Z9|A0A2K1R6Z9_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_T094200v3 PE=4 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 1.7e-05 Identity = 50/124 (40.32%), Postives = 56/124 (45.16%), Query Frame = 0
BLAST of Cla97C01G003080 vs. TrEMBL
Match: tr|A0A022REB7|A0A022REB7_ERYGU (Uncharacterized protein OS=Erythranthe guttata OX=4155 GN=MIMGU_mgv1a013131mg PE=4 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 1.9e-04 Identity = 34/75 (45.33%), Postives = 41/75 (54.67%), Query Frame = 0
BLAST of Cla97C01G003080 vs. TrEMBL
Match: tr|A0A103XQR1|A0A103XQR1_CYNCS (Thaumatin OS=Cynara cardunculus var. scolymus OX=59895 GN=Ccrd_002763 PE=4 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 2.4e-04 Identity = 24/26 (92.31%), Postives = 24/26 (92.31%), Query Frame = 0
BLAST of Cla97C01G003080 vs. TrEMBL
Match: tr|M5WLE8|M5WLE8_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica OX=3760 GN=PRUPE_ppa026060mg PE=4 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 3.2e-04 Identity = 23/31 (74.19%), Postives = 26/31 (83.87%), Query Frame = 0
BLAST of Cla97C01G003080 vs. TrEMBL
Match: tr|A0A0L9VQQ3|A0A0L9VQQ3_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan11g010600 PE=4 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 5.5e-04 Identity = 23/28 (82.14%), Postives = 25/28 (89.29%), Query Frame = 0
BLAST of Cla97C01G003080 vs. Swiss-Prot
Match: sp|P25096|P21_SOYBN (Protein P21 OS=Glycine max OX=3847 PE=1 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 3.9e-05 Identity = 21/28 (75.00%), Postives = 23/28 (82.14%), Query Frame = 0
BLAST of Cla97C01G003080 vs. Swiss-Prot
Match: sp|P81370|TLP_ACTDE (Thaumatin-like protein OS=Actinidia deliciosa OX=3627 GN=tlp PE=1 SV=2) HSP 1 Score: 49.3 bits (116), Expect = 3.9e-05 Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 0
BLAST of Cla97C01G003080 vs. Swiss-Prot
Match: sp|P50700|OSL3_ARATH (Osmotin-like protein OSM34 OS=Arabidopsis thaliana OX=3702 GN=OSM34 PE=2 SV=2) HSP 1 Score: 48.5 bits (114), Expect = 6.6e-05 Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 0
BLAST of Cla97C01G003080 vs. Swiss-Prot
Match: sp|P25871|OLPA_TOBAC (Osmotin-like protein OS=Nicotiana tabacum OX=4097 GN=OLPA PE=1 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 3.3e-04 Identity = 29/75 (38.67%), Postives = 37/75 (49.33%), Query Frame = 0
BLAST of Cla97C01G003080 vs. Swiss-Prot
Match: sp|E3SU11|ALL13_OLEEU (Thaumatin-like protein OS=Olea europaea OX=4146 PE=1 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 4.3e-04 Identity = 20/25 (80.00%), Postives = 22/25 (88.00%), Query Frame = 0
BLAST of Cla97C01G003080 vs. TAIR10
Match: AT4G11650.1 (osmotin 34) HSP 1 Score: 48.5 bits (114), Expect = 3.7e-06 Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |