Cla97C01G000080 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTACCAGTGAACTTGCTTGCACCTACGCCGCCTTGATTCTTCATGGCGACGCCATCTCCGTCGCTGTACCTATCAATTTTCCTTTTTACCTCCTTCCATTTCTAACAGCTCTCTTCTTCTTTCTTTCCATATTTTAATTTAGGCCGAGAAGATTTCCAAGTCGGTGAACGCTGCCAGCCTTACCGTCGAATCCTACTGGCCTTCTCTCTTTTCTCTCTCCATCTCATCTTCTGCCGGTAATGCCGCTCCTGCGCCCGTCGACAAGCAGGTACGCGGTTTTTTCGTACTTGCCTAAATAACAAATAATTCAAAATTAGGATTATATAAGTTTATACATGATTTTAGATCGCTGAAAGCAATTGAGCCTATAGCTCCTTCTTACTGGAGCATATATATTATTGATTTTGATTTACGTATATTCCTGGTTATATATGGTTGTATTGTACCTGTATCATATGCAGGAAGAGGTGATGGAAGAGAGCGAGGATGAGATGGTCTTGGGCTTTGTTTGA ATGTCTACCAGTGAACTTGCTTGCACCTACGCCGCCTTGATTCTTCATGGCGACGCCATCTCCGTCGCTGCCGAGAAGATTTCCAAGTCGGTGAACGCTGCCAGCCTTACCGTCGAATCCTACTGGCCTTCTCTCTTTTCTCTCTCCATCTCATCTTCTGCCGGTAATGCCGCTCCTGCGCCCGTCGACAAGCAGGAAGAGGTGATGGAAGAGAGCGAGGATGAGATGGTCTTGGGCTTTGTTTGA ATGTCTACCAGTGAACTTGCTTGCACCTACGCCGCCTTGATTCTTCATGGCGACGCCATCTCCGTCGCTGCCGAGAAGATTTCCAAGTCGGTGAACGCTGCCAGCCTTACCGTCGAATCCTACTGGCCTTCTCTCTTTTCTCTCTCCATCTCATCTTCTGCCGGTAATGCCGCTCCTGCGCCCGTCGACAAGCAGGAAGAGGTGATGGAAGAGAGCGAGGATGAGATGGTCTTGGGCTTTGTTTGA MSTSELACTYAALILHGDAISVAAEKISKSVNAASLTVESYWPSLFSLSISSSAGNAAPAPVDKQEEVMEESEDEMVLGFV
BLAST of Cla97C01G000080 vs. NCBI nr
Match: XP_022138164.1 (60S acidic ribosomal protein P1-like isoform X2 [Momordica charantia]) HSP 1 Score: 75.1 bits (183), Expect = 1.2e-10 Identity = 39/47 (82.98%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of Cla97C01G000080 vs. NCBI nr
Match: NP_197839.1 (60S acidic ribosomal protein family [Arabidopsis thaliana] >BAB11203.1 60s acidic ribosomal protein P1 [Arabidopsis thaliana] >AAY78832.1 putative 60S acidic ribosomal protein P1 [Arabidopsis thaliana] >AED93318.1 60S acidic ribosomal protein family [Arabidopsis thaliana] >OAO90506.1 hypothetical protein AXX17_AT5G24350 [Arabidopsis thaliana]) HSP 1 Score: 72.8 bits (177), Expect = 6.1e-10 Identity = 50/108 (46.30%), Postives = 62/108 (57.41%), Query Frame = 0
BLAST of Cla97C01G000080 vs. NCBI nr
Match: XP_006394706.1 (60S acidic ribosomal protein P1 [Eutrema salsugineum] >ESQ31992.1 hypothetical protein EUTSA_v10005602mg [Eutrema salsugineum]) HSP 1 Score: 70.9 bits (172), Expect = 2.3e-09 Identity = 39/70 (55.71%), Postives = 48/70 (68.57%), Query Frame = 0
BLAST of Cla97C01G000080 vs. NCBI nr
Match: XP_017608770.1 (PREDICTED: 60S acidic ribosomal protein P1-like [Gossypium arboreum] >KHG14093.1 60S acidic ribosomal P1 [Gossypium arboreum]) HSP 1 Score: 69.3 bits (168), Expect = 6.7e-09 Identity = 34/47 (72.34%), Postives = 40/47 (85.11%), Query Frame = 0
BLAST of Cla97C01G000080 vs. NCBI nr
Match: XP_012486605.1 (PREDICTED: 60S acidic ribosomal protein P1-like [Gossypium raimondii] >KJB37418.1 hypothetical protein B456_006G203500 [Gossypium raimondii] >KJB37419.1 hypothetical protein B456_006G203500 [Gossypium raimondii] >KJB37420.1 hypothetical protein B456_006G203500 [Gossypium raimondii]) HSP 1 Score: 69.3 bits (168), Expect = 6.7e-09 Identity = 34/47 (72.34%), Postives = 40/47 (85.11%), Query Frame = 0
BLAST of Cla97C01G000080 vs. TrEMBL
Match: tr|Q9FLV1|Q9FLV1_ARATH (60S acidic ribosomal protein family OS=Arabidopsis thaliana OX=3702 GN=At5g24510 PE=2 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 4.0e-10 Identity = 50/108 (46.30%), Postives = 62/108 (57.41%), Query Frame = 0
BLAST of Cla97C01G000080 vs. TrEMBL
Match: tr|A0A178U9K9|A0A178U9K9_ARATH (Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g24350 PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 4.0e-10 Identity = 50/108 (46.30%), Postives = 62/108 (57.41%), Query Frame = 0
BLAST of Cla97C01G000080 vs. TrEMBL
Match: tr|V4KQ04|V4KQ04_EUTSA (Uncharacterized protein OS=Eutrema salsugineum OX=72664 GN=EUTSA_v10005602mg PE=3 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 1.5e-09 Identity = 39/70 (55.71%), Postives = 48/70 (68.57%), Query Frame = 0
BLAST of Cla97C01G000080 vs. TrEMBL
Match: tr|A0A1U8HXU8|A0A1U8HXU8_GOSHI (60S acidic ribosomal protein P1-like OS=Gossypium hirsutum OX=3635 GN=LOC107890794 PE=3 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 4.4e-09 Identity = 34/47 (72.34%), Postives = 40/47 (85.11%), Query Frame = 0
BLAST of Cla97C01G000080 vs. TrEMBL
Match: tr|A0A0D2QDP7|A0A0D2QDP7_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_006G203500 PE=3 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 4.4e-09 Identity = 34/47 (72.34%), Postives = 40/47 (85.11%), Query Frame = 0
BLAST of Cla97C01G000080 vs. Swiss-Prot
Match: sp|P29763|RLA1_CHLRE (60S acidic ribosomal protein P1 OS=Chlamydomonas reinhardtii OX=3055 PE=3 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.7e-08 Identity = 28/47 (59.57%), Postives = 35/47 (74.47%), Query Frame = 0
BLAST of Cla97C01G000080 vs. Swiss-Prot
Match: sp|P27464|RLA1_POLPE (60S acidic ribosomal protein P1 OS=Polyorchis penicillatus OX=6091 PE=3 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.3e-08 Identity = 30/47 (63.83%), Postives = 39/47 (82.98%), Query Frame = 0
BLAST of Cla97C01G000080 vs. Swiss-Prot
Match: sp|P52855|RLA1_MAIZE (60S acidic ribosomal protein P1 OS=Zea mays OX=4577 GN=RPP1A PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.1e-08 Identity = 28/47 (59.57%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of Cla97C01G000080 vs. Swiss-Prot
Match: sp|P47955|RLA1_MOUSE (60S acidic ribosomal protein P1 OS=Mus musculus OX=10090 GN=Rplp1 PE=1 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 5.6e-07 Identity = 28/68 (41.18%), Postives = 43/68 (63.24%), Query Frame = 0
BLAST of Cla97C01G000080 vs. Swiss-Prot
Match: sp|Q56K14|RLA1_BOVIN (60S acidic ribosomal protein P1 OS=Bos taurus OX=9913 GN=RPLP1 PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 7.3e-07 Identity = 28/68 (41.18%), Postives = 42/68 (61.76%), Query Frame = 0
BLAST of Cla97C01G000080 vs. TAIR10
Match: AT5G24510.1 (60S acidic ribosomal protein family) HSP 1 Score: 72.8 bits (177), Expect = 1.1e-13 Identity = 50/108 (46.30%), Postives = 62/108 (57.41%), Query Frame = 0
BLAST of Cla97C01G000080 vs. TAIR10
Match: AT5G47700.1 (60S acidic ribosomal protein family) HSP 1 Score: 52.8 bits (125), Expect = 1.2e-07 Identity = 26/48 (54.17%), Postives = 36/48 (75.00%), Query Frame = 0
BLAST of Cla97C01G000080 vs. TAIR10
Match: AT1G01100.1 (60S acidic ribosomal protein family) HSP 1 Score: 51.2 bits (121), Expect = 3.4e-07 Identity = 25/48 (52.08%), Postives = 36/48 (75.00%), Query Frame = 0
BLAST of Cla97C01G000080 vs. TAIR10
Match: AT4G00810.1 (60S acidic ribosomal protein family) HSP 1 Score: 49.3 bits (116), Expect = 1.3e-06 Identity = 24/48 (50.00%), Postives = 35/48 (72.92%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|