Cla020681 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGTTGAGTTCCGTTTTCAGAAACAGCATCAGCGACTACAAGCGATGTCCAGTTCCTTTCTCCAGAGAGCAGCTTCGCGATATTTTCCTCAAGCACGATGGCGACGGCGACGGCCGACTTTCTCGCATGGAATTGAAATCGGCCTTCGATTCCTTAGGATCTAATTGGAGCCGTTTCAGAGCTCGTCAGTGTCTCAAAGCCGCCGATTCCGACGGCGATGGCTACGTTACTCTCGATGAACTTGATCGCCTTCTTGATTACGCTGTAAGATGCGAATACGCTATAATTTGA ATGGCGTTGAGTTCCGTTTTCAGAAACAGCATCAGCGACTACAAGCGATGTCCAGTTCCTTTCTCCAGAGAGCAGCTTCGCGATATTTTCCTCAAGCACGATGGCGACGGCGACGGCCGACTTTCTCGCATGGAATTGAAATCGGCCTTCGATTCCTTAGGATCTAATTGGAGCCGTTTCAGAGCTCGTCAGTGTCTCAAAGCCGCCGATTCCGACGGCGATGGCTACGTTACTCTCGATGAACTTGATCGCCTTCTTGATTACGCTGTAAGATGCGAATACGCTATAATTTGA ATGGCGTTGAGTTCCGTTTTCAGAAACAGCATCAGCGACTACAAGCGATGTCCAGTTCCTTTCTCCAGAGAGCAGCTTCGCGATATTTTCCTCAAGCACGATGGCGACGGCGACGGCCGACTTTCTCGCATGGAATTGAAATCGGCCTTCGATTCCTTAGGATCTAATTGGAGCCGTTTCAGAGCTCGTCAGTGTCTCAAAGCCGCCGATTCCGACGGCGATGGCTACGTTACTCTCGATGAACTTGATCGCCTTCTTGATTACGCTGTAAGATGCGAATACGCTATAATTTGA MALSSVFRNSISDYKRCPVPFSREQLRDIFLKHDGDGDGRLSRMELKSAFDSLGSNWSRFRARQCLKAADSDGDGYVTLDELDRLLDYAVRCEYAII
BLAST of Cla020681 vs. Swiss-Prot
Match: CML10_ORYSJ (Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.6e-08 Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 1
BLAST of Cla020681 vs. Swiss-Prot
Match: CML15_ORYSJ (Probable calcium-binding protein CML15 OS=Oryza sativa subsp. japonica GN=CML15 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 8.6e-07 Identity = 25/62 (40.32%), Postives = 37/62 (59.68%), Query Frame = 1
BLAST of Cla020681 vs. Swiss-Prot
Match: POLC2_JUNOX (Polcalcin Jun o 2 OS=Juniperus oxycedrus PE=1 SV=2) HSP 1 Score: 53.5 bits (127), Expect = 1.5e-06 Identity = 25/60 (41.67%), Postives = 36/60 (60.00%), Query Frame = 1
BLAST of Cla020681 vs. Swiss-Prot
Match: CML27_ARATH (Probable calcium-binding protein CML27 OS=Arabidopsis thaliana GN=CML27 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.5e-06 Identity = 22/62 (35.48%), Postives = 38/62 (61.29%), Query Frame = 1
BLAST of Cla020681 vs. TrEMBL
Match: A0A0A0L4V0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G639740 PE=4 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 8.0e-44 Identity = 88/97 (90.72%), Postives = 93/97 (95.88%), Query Frame = 1
BLAST of Cla020681 vs. TrEMBL
Match: A0A0A0LRB6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G357340 PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 3.2e-16 Identity = 42/83 (50.60%), Postives = 59/83 (71.08%), Query Frame = 1
BLAST of Cla020681 vs. TrEMBL
Match: A0A061ECW3_THECC (Calcium-binding EF-hand family protein, putative OS=Theobroma cacao GN=TCM_017146 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 8.7e-14 Identity = 41/85 (48.24%), Postives = 57/85 (67.06%), Query Frame = 1
BLAST of Cla020681 vs. TrEMBL
Match: A0A067L1J7_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_04285 PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 5.6e-13 Identity = 40/75 (53.33%), Postives = 54/75 (72.00%), Query Frame = 1
BLAST of Cla020681 vs. TrEMBL
Match: F6H000_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_18s0001g10630 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.1e-11 Identity = 37/80 (46.25%), Postives = 55/80 (68.75%), Query Frame = 1
BLAST of Cla020681 vs. NCBI nr
Match: gi|700200028|gb|KGN55186.1| (hypothetical protein Csa_4G639740 [Cucumis sativus]) HSP 1 Score: 184.1 bits (466), Expect = 1.2e-43 Identity = 88/97 (90.72%), Postives = 93/97 (95.88%), Query Frame = 1
BLAST of Cla020681 vs. NCBI nr
Match: gi|700207392|gb|KGN62511.1| (hypothetical protein Csa_2G357340 [Cucumis sativus]) HSP 1 Score: 92.4 bits (228), Expect = 4.6e-16 Identity = 42/83 (50.60%), Postives = 59/83 (71.08%), Query Frame = 1
BLAST of Cla020681 vs. NCBI nr
Match: gi|590647162|ref|XP_007031825.1| (Calcium-binding EF-hand family protein, putative [Theobroma cacao]) HSP 1 Score: 84.3 bits (207), Expect = 1.2e-13 Identity = 41/85 (48.24%), Postives = 57/85 (67.06%), Query Frame = 1
BLAST of Cla020681 vs. NCBI nr
Match: gi|643731022|gb|KDP38360.1| (hypothetical protein JCGZ_04285 [Jatropha curcas]) HSP 1 Score: 81.6 bits (200), Expect = 8.1e-13 Identity = 40/75 (53.33%), Postives = 54/75 (72.00%), Query Frame = 1
BLAST of Cla020681 vs. NCBI nr
Match: gi|658003923|ref|XP_008337060.1| (PREDICTED: probable calcium-binding protein CML10 [Malus domestica]) HSP 1 Score: 80.5 bits (197), Expect = 1.8e-12 Identity = 37/88 (42.05%), Postives = 60/88 (68.18%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|