Cla019066 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCAAATCGGCGCTGGAGACTTACGGCCACGACCTCGTCGACAAAGCAGAAAACCAAAAACTCGATCCCGTCTTCGGCCGCCACCAAGAAATCCGCCGTCTCCTCACCATTATCTGCCGTAAAACCAAAAGCAATCCCATGTTAATCGGCGAGCCTGGCGTCGGAAAAACCGCCGTCGTCGAAGGACTCGCACAGAAAATCGCCTCCGGAAATGTACCGAGCAAACTCTCCGGCGCCAGAATCGTGAGCTGGACATGGGAGCCTTAA ATGGCCAAATCGGCGCTGGAGACTTACGGCCACGACCTCGTCGACAAAGCAGAAAACCAAAAACTCGATCCCGTCTTCGGCCGCCACCAAGAAATCCGCCGTCTCCTCACCATTATCTGCCGTAAAACCAAAAGCAATCCCATGTTAATCGGCGAGCCTGGCGTCGGAAAAACCGCCGTCGTCGAAGGACTCGCACAGAAAATCGCCTCCGGAAATGTACCGAGCAAACTCTCCGGCGCCAGAATCGTGAGCTGGACATGGGAGCCTTAA ATGGCCAAATCGGCGCTGGAGACTTACGGCCACGACCTCGTCGACAAAGCAGAAAACCAAAAACTCGATCCCGTCTTCGGCCGCCACCAAGAAATCCGCCGTCTCCTCACCATTATCTGCCGTAAAACCAAAAGCAATCCCATGTTAATCGGCGAGCCTGGCGTCGGAAAAACCGCCGTCGTCGAAGGACTCGCACAGAAAATCGCCTCCGGAAATGTACCGAGCAAACTCTCCGGCGCCAGAATCGTGAGCTGGACATGGGAGCCTTAA MAKSALETYGHDLVDKAENQKLDPVFGRHQEIRRLLTIICRKTKSNPMLIGEPGVGKTAVVEGLAQKIASGNVPSKLSGARIVSWTWEP
BLAST of Cla019066 vs. Swiss-Prot
Match: CLPB_MEIRU (Chaperone protein ClpB OS=Meiothermus ruber GN=clpB PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.7e-23 Identity = 54/81 (66.67%), Postives = 63/81 (77.78%), Query Frame = 1
BLAST of Cla019066 vs. Swiss-Prot
Match: CLPB2_ARATH (Putative chaperone protein ClpB2, chloroplastic OS=Arabidopsis thaliana GN=CLPB2 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.3e-22 Identity = 51/80 (63.75%), Postives = 66/80 (82.50%), Query Frame = 1
BLAST of Cla019066 vs. Swiss-Prot
Match: CLPB_THET8 (Chaperone protein ClpB OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=clpB PE=1 SV=2) HSP 1 Score: 105.1 bits (261), Expect = 3.9e-22 Identity = 52/81 (64.20%), Postives = 61/81 (75.31%), Query Frame = 1
BLAST of Cla019066 vs. Swiss-Prot
Match: CLPB_THET2 (Chaperone protein ClpB OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=clpB PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 3.9e-22 Identity = 52/81 (64.20%), Postives = 61/81 (75.31%), Query Frame = 1
BLAST of Cla019066 vs. Swiss-Prot
Match: CLPB_BIFLO (Chaperone protein ClpB OS=Bifidobacterium longum (strain NCC 2705) GN=clpB PE=3 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 6.7e-22 Identity = 50/80 (62.50%), Postives = 62/80 (77.50%), Query Frame = 1
BLAST of Cla019066 vs. TrEMBL
Match: A0A0A0LPI1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G013170 PE=4 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 1.4e-31 Identity = 69/83 (83.13%), Postives = 77/83 (92.77%), Query Frame = 1
BLAST of Cla019066 vs. TrEMBL
Match: A0A068NYC2_9BACT (Chaperone protein ClpB OS=Fimbriimonas ginsengisoli Gsoil 348 GN=clpB PE=3 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.0e-21 Identity = 52/80 (65.00%), Postives = 65/80 (81.25%), Query Frame = 1
BLAST of Cla019066 vs. TrEMBL
Match: A0A0D0MGQ8_MEIRU (Chaperone protein ClpB OS=Meiothermus ruber GN=clpB PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.0e-21 Identity = 54/81 (66.67%), Postives = 65/81 (80.25%), Query Frame = 1
BLAST of Cla019066 vs. TrEMBL
Match: A0A0S7AQS5_MEIRU (Protein disaggregation chaperone OS=Meiothermus ruber H328 GN=MrH_0886 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.0e-21 Identity = 54/81 (66.67%), Postives = 65/81 (80.25%), Query Frame = 1
BLAST of Cla019066 vs. TrEMBL
Match: D3R0U6_MAGIU (ATPase family associated with various cellular activities (AAA) OS=Mageeibacillus indolicus (strain UPII9-5) GN=HMPREF0868_0472 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.0e-21 Identity = 50/81 (61.73%), Postives = 67/81 (82.72%), Query Frame = 1
BLAST of Cla019066 vs. NCBI nr
Match: gi|659106140|ref|XP_008453261.1| (PREDICTED: chaperone protein ClpB1 [Cucumis melo]) HSP 1 Score: 149.4 bits (376), Expect = 2.9e-33 Identity = 72/83 (86.75%), Postives = 79/83 (95.18%), Query Frame = 1
BLAST of Cla019066 vs. NCBI nr
Match: gi|449441089|ref|XP_004138316.1| (PREDICTED: chaperone protein ClpB1 [Cucumis sativus]) HSP 1 Score: 143.3 bits (360), Expect = 2.1e-31 Identity = 69/83 (83.13%), Postives = 77/83 (92.77%), Query Frame = 1
BLAST of Cla019066 vs. NCBI nr
Match: gi|749588956|ref|WP_040215227.1| (ATP-dependent chaperone ClpB [Clostridium polynesiense]) HSP 1 Score: 111.7 bits (278), Expect = 6.7e-22 Identity = 54/79 (68.35%), Postives = 63/79 (79.75%), Query Frame = 1
BLAST of Cla019066 vs. NCBI nr
Match: gi|643548751|ref|WP_025228124.1| (ATP-dependent chaperone ClpB [Fimbriimonas ginsengisoli]) HSP 1 Score: 110.5 bits (275), Expect = 1.5e-21 Identity = 52/80 (65.00%), Postives = 65/80 (81.25%), Query Frame = 1
BLAST of Cla019066 vs. NCBI nr
Match: gi|654416887|ref|WP_027888253.1| (ATP-dependent chaperone ClpB [Meiothermus taiwanensis]) HSP 1 Score: 109.0 bits (271), Expect = 4.3e-21 Identity = 54/81 (66.67%), Postives = 65/81 (80.25%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |