Cla015948 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGAAGGTGGAAATTATTGTGGGTGTCGCCAATATCTACGCCACCATCGGCACTGCCATCGCGGGTAGAACCTCCGACTATATCGGCCACCGTTACACCATGGTTCTTGTAGGTTTCATTTTCTTCTTTGGCGCTTTTCTCATGGGCTTTGCCACCAACTTTGTCTCCCTCATGCTCGGCCAATTCATCATTGGACTCGGCACCGGATACGCTTTAGTTGTATCCCCTGTCTACATTGCCGATGTATCTCCGACGTCGTCTCGTGGCTTCTTCACCTCTGATATTTACTAA ATGTGGAAGGTGGAAATTATTGTGGGTGTCGCCAATATCTACGCCACCATCGGCACTGCCATCGCGGGTAGAACCTCCGACTATATCGGCCACCGTTACACCATGGTTCTTGTAGGTTTCATTTTCTTCTTTGGCGCTTTTCTCATGGGCTTTGCCACCAACTTTGTCTCCCTCATGCTCGGCCAATTCATCATTGGACTCGGCACCGGATACGCTTTAGTTGTATCCCCTGTCTACATTGCCGATGTATCTCCGACGTCGTCTCGTGGCTTCTTCACCTCTGATATTTACTAA ATGTGGAAGGTGGAAATTATTGTGGGTGTCGCCAATATCTACGCCACCATCGGCACTGCCATCGCGGGTAGAACCTCCGACTATATCGGCCACCGTTACACCATGGTTCTTGTAGGTTTCATTTTCTTCTTTGGCGCTTTTCTCATGGGCTTTGCCACCAACTTTGTCTCCCTCATGCTCGGCCAATTCATCATTGGACTCGGCACCGGATACGCTTTAGTTGTATCCCCTGTCTACATTGCCGATGTATCTCCGACGTCGTCTCGTGGCTTCTTCACCTCTGATATTTACTAA MWKVEIIVGVANIYATIGTAIAGRTSDYIGHRYTMVLVGFIFFFGAFLMGFATNFVSLMLGQFIIGLGTGYALVVSPVYIADVSPTSSRGFFTSDIY
BLAST of Cla015948 vs. Swiss-Prot
Match: PLT2_ARATH (Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.6e-27 Identity = 53/92 (57.61%), Postives = 73/92 (79.35%), Query Frame = 1
BLAST of Cla015948 vs. Swiss-Prot
Match: PLT1_ARATH (Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 5.7e-27 Identity = 52/92 (56.52%), Postives = 73/92 (79.35%), Query Frame = 1
BLAST of Cla015948 vs. Swiss-Prot
Match: PLT5_ARATH (Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2) HSP 1 Score: 115.5 bits (288), Expect = 3.2e-25 Identity = 54/92 (58.70%), Postives = 67/92 (72.83%), Query Frame = 1
BLAST of Cla015948 vs. Swiss-Prot
Match: PLT3_ARATH (Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 8.9e-20 Identity = 43/92 (46.74%), Postives = 63/92 (68.48%), Query Frame = 1
BLAST of Cla015948 vs. Swiss-Prot
Match: PLT6_ARATH (Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2) HSP 1 Score: 93.6 bits (231), Expect = 1.3e-18 Identity = 41/92 (44.57%), Postives = 61/92 (66.30%), Query Frame = 1
BLAST of Cla015948 vs. TrEMBL
Match: A0A0A0K3P7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G253800 PE=3 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.6e-34 Identity = 75/93 (80.65%), Postives = 82/93 (88.17%), Query Frame = 1
BLAST of Cla015948 vs. TrEMBL
Match: A0A161YDQ6_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_001593 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.6e-28 Identity = 59/92 (64.13%), Postives = 78/92 (84.78%), Query Frame = 1
BLAST of Cla015948 vs. TrEMBL
Match: A0A0A0K487_CUCSA (Sugar transporter OS=Cucumis sativus GN=Csa_7G253780 PE=3 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 6.2e-28 Identity = 61/90 (67.78%), Postives = 73/90 (81.11%), Query Frame = 1
BLAST of Cla015948 vs. TrEMBL
Match: Q9FQX3_APIGR (Mannitol transporter OS=Apium graveolens Dulce Group GN=Mat1 PE=2 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 8.1e-28 Identity = 58/92 (63.04%), Postives = 76/92 (82.61%), Query Frame = 1
BLAST of Cla015948 vs. TrEMBL
Match: Q1AN24_OLEEU (Mannitol transporter 1 OS=Olea europaea PE=2 SV=2) HSP 1 Score: 130.6 bits (327), Expect = 1.1e-27 Identity = 59/92 (64.13%), Postives = 76/92 (82.61%), Query Frame = 1
BLAST of Cla015948 vs. NCBI nr
Match: gi|659092410|ref|XP_008447048.1| (PREDICTED: LOW QUALITY PROTEIN: putative polyol transporter 2 [Cucumis melo]) HSP 1 Score: 153.7 bits (387), Expect = 1.7e-34 Identity = 76/93 (81.72%), Postives = 81/93 (87.10%), Query Frame = 1
BLAST of Cla015948 vs. NCBI nr
Match: gi|449461166|ref|XP_004148313.1| (PREDICTED: putative polyol transporter 1 isoform X1 [Cucumis sativus]) HSP 1 Score: 152.5 bits (384), Expect = 3.7e-34 Identity = 75/93 (80.65%), Postives = 82/93 (88.17%), Query Frame = 1
BLAST of Cla015948 vs. NCBI nr
Match: gi|778726176|ref|XP_011659069.1| (PREDICTED: putative polyol transporter 1 isoform X2 [Cucumis sativus]) HSP 1 Score: 152.5 bits (384), Expect = 3.7e-34 Identity = 75/93 (80.65%), Postives = 82/93 (88.17%), Query Frame = 1
BLAST of Cla015948 vs. NCBI nr
Match: gi|659092943|ref|XP_008447302.1| (PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis melo]) HSP 1 Score: 148.7 bits (374), Expect = 5.4e-33 Identity = 72/90 (80.00%), Postives = 80/90 (88.89%), Query Frame = 1
BLAST of Cla015948 vs. NCBI nr
Match: gi|1021051159|gb|KZN08937.1| (hypothetical protein DCAR_001593 [Daucus carota subsp. sativus]) HSP 1 Score: 133.3 bits (334), Expect = 2.3e-28 Identity = 59/92 (64.13%), Postives = 78/92 (84.78%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |