Cla015868 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTCCGCTTGCCTAGCATTGTTCATGCTAAGCAAAGTTTTCGGCGATCTTCGTCAACAGGAAATGGAGCATCTCCAAAGGCTATAGATGTTCCAAAGGACTACTTTGCAGTTTATGTTGGTGAGGCACAAAAGAAACGTTTTGTCATCCCACTATCTTGCTTGAACCAACCTTCATTTCAAGATTTATTGAGTCAAGCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGAAACTTTTCTCAGTCTCATGCAAAGCTGA ATGGGTTTCCGCTTGCCTAGCATTGTTCATGCTAAGCAAAGTTTTCGGCGATCTTCGTCAACAGGAAATGGAGCATCTCCAAAGGCTATAGATGTTCCAAAGGACTACTTTGCAGTTTATGTTGGTGAGGCACAAAAGAAACGTTTTGTCATCCCACTATCTTGCTTGAACCAACCTTCATTTCAAGATTTATTGAGTCAAGCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGAAACTTTTCTCAGTCTCATGCAAAGCTGA ATGGGTTTCCGCTTGCCTAGCATTGTTCATGCTAAGCAAAGTTTTCGGCGATCTTCGTCAACAGGAAATGGAGCATCTCCAAAGGCTATAGATGTTCCAAAGGACTACTTTGCAGTTTATGTTGGTGAGGCACAAAAGAAACGTTTTGTCATCCCACTATCTTGCTTGAACCAACCTTCATTTCAAGATTTATTGAGTCAAGCAGAAGAAGAATTTGGATATGATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGAAACTTTTCTCAGTCTCATGCAAAGCTGA MGFRLPSIVHAKQSFRRSSSTGNGASPKAIDVPKDYFAVYVGEAQKKRFVIPLSCLNQPSFQDLLSQAEEEFGYDHPMGGITIPCSEETFLSLMQS
BLAST of Cla015868 vs. Swiss-Prot
Match: ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata GN=ARG7 PE=2 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.1e-25 Identity = 61/90 (67.78%), Postives = 65/90 (72.22%), Query Frame = 1
BLAST of Cla015868 vs. Swiss-Prot
Match: AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.8e-25 Identity = 57/93 (61.29%), Postives = 70/93 (75.27%), Query Frame = 1
BLAST of Cla015868 vs. Swiss-Prot
Match: AX6B_SOYBN (Auxin-induced protein 6B OS=Glycine max PE=2 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 9.1e-25 Identity = 59/90 (65.56%), Postives = 67/90 (74.44%), Query Frame = 1
BLAST of Cla015868 vs. Swiss-Prot
Match: A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max PE=2 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 5.9e-24 Identity = 57/93 (61.29%), Postives = 68/93 (73.12%), Query Frame = 1
BLAST of Cla015868 vs. Swiss-Prot
Match: AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.0e-23 Identity = 60/90 (66.67%), Postives = 64/90 (71.11%), Query Frame = 1
BLAST of Cla015868 vs. TrEMBL
Match: A0A0A0K2F0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008460 PE=4 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 7.7e-39 Identity = 81/96 (84.38%), Postives = 85/96 (88.54%), Query Frame = 1
BLAST of Cla015868 vs. TrEMBL
Match: A0A0A0K4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008980 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 8.5e-38 Identity = 80/96 (83.33%), Postives = 86/96 (89.58%), Query Frame = 1
BLAST of Cla015868 vs. TrEMBL
Match: A0A0A0K5T8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009020 PE=4 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.2e-37 Identity = 79/96 (82.29%), Postives = 83/96 (86.46%), Query Frame = 1
BLAST of Cla015868 vs. TrEMBL
Match: A0A0A0K160_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008990 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 2.7e-36 Identity = 76/95 (80.00%), Postives = 84/95 (88.42%), Query Frame = 1
BLAST of Cla015868 vs. TrEMBL
Match: A0A0A0K0H9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009010 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 5.2e-35 Identity = 76/96 (79.17%), Postives = 83/96 (86.46%), Query Frame = 1
BLAST of Cla015868 vs. NCBI nr
Match: gi|700187966|gb|KGN43199.1| (hypothetical protein Csa_7G008460 [Cucumis sativus]) HSP 1 Score: 167.5 bits (423), Expect = 1.1e-38 Identity = 81/96 (84.38%), Postives = 85/96 (88.54%), Query Frame = 1
BLAST of Cla015868 vs. NCBI nr
Match: gi|778722823|ref|XP_011658575.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 164.1 bits (414), Expect = 1.2e-37 Identity = 80/96 (83.33%), Postives = 86/96 (89.58%), Query Frame = 1
BLAST of Cla015868 vs. NCBI nr
Match: gi|659094352|ref|XP_008448014.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 162.9 bits (411), Expect = 2.7e-37 Identity = 79/95 (83.16%), Postives = 86/95 (90.53%), Query Frame = 1
BLAST of Cla015868 vs. NCBI nr
Match: gi|778722830|ref|XP_004144905.2| (PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]) HSP 1 Score: 161.8 bits (408), Expect = 6.1e-37 Identity = 79/96 (82.29%), Postives = 83/96 (86.46%), Query Frame = 1
BLAST of Cla015868 vs. NCBI nr
Match: gi|778722820|ref|XP_011658574.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 159.1 bits (401), Expect = 3.9e-36 Identity = 76/95 (80.00%), Postives = 84/95 (88.42%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |