Cla015867 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTCCGCTTGCCTAGAATTGTTCATGCTAAGCAAAGTCTTCAGCGATCTTCATCAACAGGAAATGGAGCATCTCCAAAGGCTGTTGATGTTCCTAAGGGCTATTTTACCGTTTATGTCGGTGAGGAACAAAAGAAGCGTTTTATCATCCCACTATCTTACTTGAACCAACCTTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCGATGGGCGGCATCACAATTCCTTGTAGTGAAGAAATTTTCCTAAATCTCACGCAGAGTTTGAATGACTCATGA ATGGGTTTCCGCTTGCCTAGAATTGTTCATGCTAAGCAAAGTCTTCAGCGATCTTCATCAACAGGAAATGGAGCATCTCCAAAGGCTGTTGATGTTCCTAAGGGCTATTTTACCGTTTATGTCGGTGAGGAACAAAAGAAGCGTTTTATCATCCCACTATCTTACTTGAACCAACCTTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCGATGGGCGGCATCACAATTCCTTGTAGTGAAGAAATTTTCCTAAATCTCACGCAGAGTTTGAATGACTCATGA ATGGGTTTCCGCTTGCCTAGAATTGTTCATGCTAAGCAAAGTCTTCAGCGATCTTCATCAACAGGAAATGGAGCATCTCCAAAGGCTGTTGATGTTCCTAAGGGCTATTTTACCGTTTATGTCGGTGAGGAACAAAAGAAGCGTTTTATCATCCCACTATCTTACTTGAACCAACCTTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCGATGGGCGGCATCACAATTCCTTGTAGTGAAGAAATTTTCCTAAATCTCACGCAGAGTTTGAATGACTCATGA MGFRLPRIVHAKQSLQRSSSTGNGASPKAVDVPKGYFTVYVGEEQKKRFIIPLSYLNQPSFQDLLSQAEEEFGYNHPMGGITIPCSEEIFLNLTQSLNDS
BLAST of Cla015867 vs. Swiss-Prot
Match: AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max PE=2 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.4e-28 Identity = 62/99 (62.63%), Postives = 75/99 (75.76%), Query Frame = 1
BLAST of Cla015867 vs. Swiss-Prot
Match: AX6B_SOYBN (Auxin-induced protein 6B OS=Glycine max PE=2 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 9.1e-28 Identity = 62/98 (63.27%), Postives = 75/98 (76.53%), Query Frame = 1
BLAST of Cla015867 vs. Swiss-Prot
Match: ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata GN=ARG7 PE=2 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.0e-26 Identity = 60/98 (61.22%), Postives = 72/98 (73.47%), Query Frame = 1
BLAST of Cla015867 vs. Swiss-Prot
Match: A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max PE=2 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.9e-26 Identity = 61/99 (61.62%), Postives = 73/99 (73.74%), Query Frame = 1
BLAST of Cla015867 vs. Swiss-Prot
Match: AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max PE=2 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 8.6e-26 Identity = 61/98 (62.24%), Postives = 67/98 (68.37%), Query Frame = 1
BLAST of Cla015867 vs. TrEMBL
Match: A0A0A0K4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008980 PE=4 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 2.6e-45 Identity = 91/100 (91.00%), Postives = 96/100 (96.00%), Query Frame = 1
BLAST of Cla015867 vs. TrEMBL
Match: A0A0A0K5T8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009020 PE=4 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 7.5e-45 Identity = 91/100 (91.00%), Postives = 95/100 (95.00%), Query Frame = 1
BLAST of Cla015867 vs. TrEMBL
Match: A0A0A0K160_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008990 PE=4 SV=1) HSP 1 Score: 185.3 bits (469), Expect = 3.7e-44 Identity = 88/100 (88.00%), Postives = 96/100 (96.00%), Query Frame = 1
BLAST of Cla015867 vs. TrEMBL
Match: A0A0A0K0H9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009010 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 5.9e-42 Identity = 85/99 (85.86%), Postives = 92/99 (92.93%), Query Frame = 1
BLAST of Cla015867 vs. TrEMBL
Match: A0A0A0K0H6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008960 PE=4 SV=1) HSP 1 Score: 172.9 bits (437), Expect = 1.9e-40 Identity = 86/102 (84.31%), Postives = 92/102 (90.20%), Query Frame = 1
BLAST of Cla015867 vs. NCBI nr
Match: gi|778722823|ref|XP_011658575.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 189.1 bits (479), Expect = 3.7e-45 Identity = 91/100 (91.00%), Postives = 96/100 (96.00%), Query Frame = 1
BLAST of Cla015867 vs. NCBI nr
Match: gi|778722830|ref|XP_004144905.2| (PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]) HSP 1 Score: 187.6 bits (475), Expect = 1.1e-44 Identity = 91/100 (91.00%), Postives = 95/100 (95.00%), Query Frame = 1
BLAST of Cla015867 vs. NCBI nr
Match: gi|659094352|ref|XP_008448014.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 186.8 bits (473), Expect = 1.8e-44 Identity = 88/100 (88.00%), Postives = 96/100 (96.00%), Query Frame = 1
BLAST of Cla015867 vs. NCBI nr
Match: gi|659094350|ref|XP_008448013.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 186.8 bits (473), Expect = 1.8e-44 Identity = 92/99 (92.93%), Postives = 94/99 (94.95%), Query Frame = 1
BLAST of Cla015867 vs. NCBI nr
Match: gi|778722820|ref|XP_011658574.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 185.3 bits (469), Expect = 5.3e-44 Identity = 88/100 (88.00%), Postives = 96/100 (96.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |