Cla015860 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGCTTCTCCATCTTCTTAAAAGAAGCCAAGGCGTTTCAGCAATTCCCAAGGGCTATTTTGCGGTATACGTCGGAGAGAGCCAAAAGAAGCGGTTTGTGATTCCGATTACTTACTTGAATCAACCATGGTTTCAAGAGTTGCTTAGTCAGACTGAAGAAGAATTCGGTTACCATCATCCAATAGGAGGTCTTACTATTCATTGCGAAGATGATATCTTCATTGACCTCATCTCTCGTTTGAATGATCTATGA ATGGGGCTTCTCCATCTTCTTAAAAGAAGCCAAGGCGTTTCAGCAATTCCCAAGGGCTATTTTGCGGTATACGTCGGAGAGAGCCAAAAGAAGCGGTTTGTGATTCCGATTACTTACTTGAATCAACCATGGTTTCAAGAGTTGCTTAGTCAGACTGAAGAAGAATTCGGTTACCATCATCCAATAGGAGGTCTTACTATTCATTGCGAAGATGATATCTTCATTGACCTCATCTCTCGTTTGAATGATCTATGA ATGGGGCTTCTCCATCTTCTTAAAAGAAGCCAAGGCGTTTCAGCAATTCCCAAGGGCTATTTTGCGGTATACGTCGGAGAGAGCCAAAAGAAGCGGTTTGTGATTCCGATTACTTACTTGAATCAACCATGGTTTCAAGAGTTGCTTAGTCAGACTGAAGAAGAATTCGGTTACCATCATCCAATAGGAGGTCTTACTATTCATTGCGAAGATGATATCTTCATTGACCTCATCTCTCGTTTGAATGATCTATGA MGLLHLLKRSQGVSAIPKGYFAVYVGESQKKRFVIPITYLNQPWFQELLSQTEEEFGYHHPIGGLTIHCEDDIFIDLISRLNDL
BLAST of Cla015860 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 4.4e-23 Identity = 51/82 (62.20%), Postives = 64/82 (78.05%), Query Frame = 1
BLAST of Cla015860 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.7e-22 Identity = 50/82 (60.98%), Postives = 64/82 (78.05%), Query Frame = 1
BLAST of Cla015860 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.8e-22 Identity = 48/77 (62.34%), Postives = 62/77 (80.52%), Query Frame = 1
BLAST of Cla015860 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 4.8e-22 Identity = 50/81 (61.73%), Postives = 62/81 (76.54%), Query Frame = 1
BLAST of Cla015860 vs. Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.1e-21 Identity = 49/81 (60.49%), Postives = 63/81 (77.78%), Query Frame = 1
BLAST of Cla015860 vs. TrEMBL
Match: A0A0A0K5U4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009070 PE=4 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 3.8e-34 Identity = 72/84 (85.71%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of Cla015860 vs. TrEMBL
Match: A0A0A0K4K1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009080 PE=4 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.2e-32 Identity = 69/84 (82.14%), Postives = 76/84 (90.48%), Query Frame = 1
BLAST of Cla015860 vs. TrEMBL
Match: A0A0A0K5V1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009120 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 7.7e-27 Identity = 63/88 (71.59%), Postives = 71/88 (80.68%), Query Frame = 1
BLAST of Cla015860 vs. TrEMBL
Match: A0A0A0K2F9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009050 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 3.2e-25 Identity = 60/87 (68.97%), Postives = 71/87 (81.61%), Query Frame = 1
BLAST of Cla015860 vs. TrEMBL
Match: K4B3T6_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.0e-23 Identity = 51/77 (66.23%), Postives = 68/77 (88.31%), Query Frame = 1
BLAST of Cla015860 vs. NCBI nr
Match: gi|778722852|ref|XP_011658582.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 151.8 bits (382), Expect = 5.5e-34 Identity = 72/84 (85.71%), Postives = 79/84 (94.05%), Query Frame = 1
BLAST of Cla015860 vs. NCBI nr
Match: gi|700187979|gb|KGN43212.1| (hypothetical protein Csa_7G009080 [Cucumis sativus]) HSP 1 Score: 146.7 bits (369), Expect = 1.8e-32 Identity = 69/84 (82.14%), Postives = 76/84 (90.48%), Query Frame = 1
BLAST of Cla015860 vs. NCBI nr
Match: gi|700187983|gb|KGN43216.1| (hypothetical protein Csa_7G009120 [Cucumis sativus]) HSP 1 Score: 127.5 bits (319), Expect = 1.1e-26 Identity = 63/88 (71.59%), Postives = 71/88 (80.68%), Query Frame = 1
BLAST of Cla015860 vs. NCBI nr
Match: gi|700187976|gb|KGN43209.1| (hypothetical protein Csa_7G009050 [Cucumis sativus]) HSP 1 Score: 122.1 bits (305), Expect = 4.7e-25 Identity = 60/87 (68.97%), Postives = 71/87 (81.61%), Query Frame = 1
BLAST of Cla015860 vs. NCBI nr
Match: gi|764590399|ref|XP_011465140.1| (PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria vesca subsp. vesca]) HSP 1 Score: 117.1 bits (292), Expect = 1.5e-23 Identity = 53/69 (76.81%), Postives = 61/69 (88.41%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |