Cla013084 (gene) Watermelon (97103) v1

NameCla013084
Typegene
OrganismCitrullus. lanatus (Watermelon (97103) v1)
DescriptionUnknown Protein (AHRD V1)
LocationChr5 : 10691277 .. 10691474 (+)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGAACTTTTATTCTCTTCTTCGTGTCACGGTCGCACTCTCAATCCACTGTGCTTCACCTATGTCGGCAGCCTCACCTTTACCAGTGGTTGTCGTCTGCACGTCGCTCCACCAAGACGCCGCAACCCGTGTTAACGTCTGTTCACCGCGTAGTCTTCCAACTGAGCTCACTGCCGCCAATTGTTTAGTGCCTCCTTAG

mRNA sequence

ATGAACTTTTATTCTCTTCTTCGTGTCACGGTCGCACTCTCAATCCACTGTGCTTCACCTATGTCGGCAGCCTCACCTTTACCAGTGGTTGTCGTCTGCACGTCGCTCCACCAAGACGCCGCAACCCGTGTTAACGTCTGTTCACCGCGTAGTCTTCCAACTGAGCTCACTGCCGCCAATTGTTTAGTGCCTCCTTAG

Coding sequence (CDS)

ATGAACTTTTATTCTCTTCTTCGTGTCACGGTCGCACTCTCAATCCACTGTGCTTCACCTATGTCGGCAGCCTCACCTTTACCAGTGGTTGTCGTCTGCACGTCGCTCCACCAAGACGCCGCAACCCGTGTTAACGTCTGTTCACCGCGTAGTCTTCCAACTGAGCTCACTGCCGCCAATTGTTTAGTGCCTCCTTAG

Protein sequence

MNFYSLLRVTVALSIHCASPMSAASPLPVVVVCTSLHQDAATRVNVCSPRSLPTELTAANCLVPP
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
biological_process GO:0006412 translation
cellular_component GO:0005575 cellular_component
cellular_component GO:0005840 ribosome
molecular_function GO:0003674 molecular_function
molecular_function GO:0003735 structural constituent of ribosome
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
WMU36103watermelon unigene v2 vs TrEMBLtranscribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
Cla013084Cla013084.1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
WMU36103WMU36103transcribed_cluster


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
Cla013084Cucumber (Gy14) v1cgywmB423
Cla013084Cucumber (Gy14) v1cgywmB462
Cla013084Cucurbita maxima (Rimu)cmawmB114
Cla013084Cucurbita maxima (Rimu)cmawmB317
Cla013084Cucurbita maxima (Rimu)cmawmB496
Cla013084Cucurbita maxima (Rimu)cmawmB703
Cla013084Cucurbita moschata (Rifu)cmowmB098
Cla013084Cucurbita moschata (Rifu)cmowmB311
Cla013084Cucurbita moschata (Rifu)cmowmB490
Cla013084Cucurbita moschata (Rifu)cmowmB699
Cla013084Melon (DHL92) v3.5.1mewmB231
Cla013084Melon (DHL92) v3.5.1mewmB461
Cla013084Melon (DHL92) v3.5.1mewmB568
Cla013084Watermelon (Charleston Gray)wcgwmB135
Cla013084Watermelon (Charleston Gray)wcgwmB190
Cla013084Watermelon (Charleston Gray)wcgwmB286
Cla013084Cucumber (Chinese Long) v2cuwmB243
Cla013084Cucumber (Chinese Long) v2cuwmB590
Cla013084Cucurbita pepo (Zucchini)cpewmB228
Cla013084Cucurbita pepo (Zucchini)cpewmB261
Cla013084Cucurbita pepo (Zucchini)cpewmB433
Cla013084Cucurbita pepo (Zucchini)cpewmB656
Cla013084Bottle gourd (USVL1VR-Ls)lsiwmB255
Cla013084Bottle gourd (USVL1VR-Ls)lsiwmB361
Cla013084Cucumber (Gy14) v2cgybwmB229
Cla013084Cucumber (Gy14) v2cgybwmB553
Cla013084Melon (DHL92) v3.6.1medwmB226
Cla013084Melon (DHL92) v3.6.1medwmB448
Cla013084Melon (DHL92) v3.6.1medwmB557
Cla013084Silver-seed gourdcarwmB0197
Cla013084Silver-seed gourdcarwmB0288
Cla013084Silver-seed gourdcarwmB0371
Cla013084Cucumber (Chinese Long) v3cucwmB252
Cla013084Cucumber (Chinese Long) v3cucwmB618
Cla013084Watermelon (97103) v2wmwmbB202
Cla013084Watermelon (97103) v2wmwmbB206
Cla013084Wax gourdwgowmB202
Cla013084Wax gourdwgowmB271
Cla013084Watermelon (97103) v1wmwmB131