Cla012967 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGGATTCAGATTTCAATACAAAGCTTGGAGATTTTGGGTTGGCTAGGCTAGTGGACCATGCCATAGGTTCACAAACAACAGTTCTTGCTGTTACAATGGGCTACATGGCTCCTGAATGTGCTACAATAGGAAGAGCCAGTAAGGAATCAGATGTATTCAGCTTTGGGATTGTGGCTTTGGAATTGCTTGTGGAAGAAGACCCTTTGACCCCAATATAGAGGAAGGCAAAACGGTGATGCTAAAGTGGGGTTGGGAGCTTTATGGCCAGGGAAGGCTTCTTGAAGCAGCCGACTCGAAATTCCATTGGAGCTTCGAAGATGAAGCTCAACAGCAACAACAGATAGAGTGTGTGATGGTTTTGTTGATCTATGGTGTGCTCATCCAGATATAA ATGTTGGATTCAGATTTCAATACAAAGCTTGGAGATTTTGGGTTGGCTAGGCTAGTGGACCATGCCATAGGTTCACAAACAACAGTTCTTGCTGTTACAATGGGCTACATGGCTCCTGAATGTGCTACAATAGGAAGAGCCAAGGAAGGCAAAACGGTGATGCTAAAGTGGGGTTGGGAGCTTTATGGCCAGGGAAGGCTTCTTGAAGCAGCCGACTCGAAATTCCATTGGAGCTTCGAAGATGAAGCTCAACAGCAACAACAGATAGAGTGTGTGATGGTTTTGTTGATCTATGGTGTGCTCATCCAGATATAA ATGTTGGATTCAGATTTCAATACAAAGCTTGGAGATTTTGGGTTGGCTAGGCTAGTGGACCATGCCATAGGTTCACAAACAACAGTTCTTGCTGTTACAATGGGCTACATGGCTCCTGAATGTGCTACAATAGGAAGAGCCAAGGAAGGCAAAACGGTGATGCTAAAGTGGGGTTGGGAGCTTTATGGCCAGGGAAGGCTTCTTGAAGCAGCCGACTCGAAATTCCATTGGAGCTTCGAAGATGAAGCTCAACAGCAACAACAGATAGAGTGTGTGATGGTTTTGTTGATCTATGGTGTGCTCATCCAGATATAA MLDSDFNTKLGDFGLARLVDHAIGSQTTVLAVTMGYMAPECATIGRAKEGKTVMLKWGWELYGQGRLLEAADSKFHWSFEDEAQQQQQIECVMVLLIYGVLIQI
BLAST of Cla012967 vs. Swiss-Prot
Match: LRK91_ARATH (L-type lectin-domain containing receptor kinase IX.1 OS=Arabidopsis thaliana GN=LECRK91 PE=1 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 4.1e-15 Identity = 50/124 (40.32%), Postives = 63/124 (50.81%), Query Frame = 1
BLAST of Cla012967 vs. Swiss-Prot
Match: LRKS7_ARATH (Probable L-type lectin-domain containing receptor kinase S.7 OS=Arabidopsis thaliana GN=LECRKS7 PE=2 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.8e-11 Identity = 41/114 (35.96%), Postives = 56/114 (49.12%), Query Frame = 1
BLAST of Cla012967 vs. Swiss-Prot
Match: LRK92_ARATH (L-type lectin-domain containing receptor kinase IX.2 OS=Arabidopsis thaliana GN=LECRK92 PE=1 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.1e-10 Identity = 32/49 (65.31%), Postives = 35/49 (71.43%), Query Frame = 1
BLAST of Cla012967 vs. Swiss-Prot
Match: CHARK_ORYSJ (Probable kinase CHARK OS=Oryza sativa subsp. japonica GN=CHARK PE=2 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.4e-09 Identity = 45/123 (36.59%), Postives = 60/123 (48.78%), Query Frame = 1
BLAST of Cla012967 vs. Swiss-Prot
Match: LRK81_ARATH (L-type lectin-domain containing receptor kinase VIII.1 OS=Arabidopsis thaliana GN=LECRK81 PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 4.4e-09 Identity = 32/58 (55.17%), Postives = 37/58 (63.79%), Query Frame = 1
HSP 2 Score: 45.1 bits (105), Expect = 5.6e-04 Identity = 33/115 (28.70%), Postives = 47/115 (40.87%), Query Frame = 1
BLAST of Cla012967 vs. TrEMBL
Match: E5GCR4_CUCME (Putative kinase OS=Cucumis melo subsp. melo PE=3 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 6.8e-33 Identity = 78/122 (63.93%), Postives = 85/122 (69.67%), Query Frame = 1
BLAST of Cla012967 vs. TrEMBL
Match: A0A0A0K286_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G067400 PE=3 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 1.7e-31 Identity = 76/122 (62.30%), Postives = 84/122 (68.85%), Query Frame = 1
BLAST of Cla012967 vs. TrEMBL
Match: A0A151RHN8_CAJCA (Lectin-domain containing receptor kinase A4.2 OS=Cajanus cajan GN=KK1_036487 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 6.4e-23 Identity = 58/122 (47.54%), Postives = 77/122 (63.11%), Query Frame = 1
BLAST of Cla012967 vs. TrEMBL
Match: A0A0B2PPZ6_GLYSO (L-type lectin-domain containing receptor kinase IX.1 OS=Glycine soja GN=glysoja_049177 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 8.4e-23 Identity = 58/122 (47.54%), Postives = 76/122 (62.30%), Query Frame = 1
BLAST of Cla012967 vs. TrEMBL
Match: A0A0B2PID7_GLYSO (L-type lectin-domain containing receptor kinase IX.1 OS=Glycine soja GN=glysoja_042226 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 8.4e-23 Identity = 58/122 (47.54%), Postives = 76/122 (62.30%), Query Frame = 1
BLAST of Cla012967 vs. NCBI nr
Match: gi|659110225|ref|XP_008455115.1| (PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis melo]) HSP 1 Score: 147.9 bits (372), Expect = 9.8e-33 Identity = 78/122 (63.93%), Postives = 85/122 (69.67%), Query Frame = 1
BLAST of Cla012967 vs. NCBI nr
Match: gi|307136457|gb|ADN34262.1| (putative kinase [Cucumis melo subsp. melo]) HSP 1 Score: 147.9 bits (372), Expect = 9.8e-33 Identity = 78/122 (63.93%), Postives = 85/122 (69.67%), Query Frame = 1
BLAST of Cla012967 vs. NCBI nr
Match: gi|449438588|ref|XP_004137070.1| (PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Cucumis sativus]) HSP 1 Score: 143.3 bits (360), Expect = 2.4e-31 Identity = 76/122 (62.30%), Postives = 84/122 (68.85%), Query Frame = 1
BLAST of Cla012967 vs. NCBI nr
Match: gi|1012330599|gb|KYP42114.1| (Lectin-domain containing receptor kinase A4.2 [Cajanus cajan]) HSP 1 Score: 114.8 bits (286), Expect = 9.2e-23 Identity = 58/122 (47.54%), Postives = 77/122 (63.11%), Query Frame = 1
BLAST of Cla012967 vs. NCBI nr
Match: gi|947096920|gb|KRH45505.1| (hypothetical protein GLYMA_08G275400 [Glycine max]) HSP 1 Score: 114.4 bits (285), Expect = 1.2e-22 Identity = 58/122 (47.54%), Postives = 76/122 (62.30%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |