Cla012854 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAAGGGCTTTACCCGCAATCACCTCTACGGTTGGGGGATTCGAATGGTGGAATGAAATTGATGAATCTGAGGATTGGCAGAAAGGGATTTACTACGCCTTGTCCGCCTCTTATGCCCTCATCTCCCTCATTGCCTTAGTACTCTACTTTTCTCTTTTCCTTACTGTCTTTTTGTCCTGTATCTTCTGA ATGGCAAGGGCTTTACCCGCAATCACCTCTACGGTTGGGGGATTCGAATGGTGGAATGAAATTGATGAATCTGAGGATTGGCAGAAAGGGATTTACTACGCCTTGTCCGCCTCTTATGCCCTCATCTCCCTCATTGCCTTAGTACTCTACTTTTCTCTTTTCCTTACTGTCTTTTTGTCCTGTATCTTCTGA ATGGCAAGGGCTTTACCCGCAATCACCTCTACGGTTGGGGGATTCGAATGGTGGAATGAAATTGATGAATCTGAGGATTGGCAGAAAGGGATTTACTACGCCTTGTCCGCCTCTTATGCCCTCATCTCCCTCATTGCCTTAGTACTCTACTTTTCTCTTTTCCTTACTGTCTTTTTGTCCTGTATCTTCTGA MARALPAITSTVGGFEWWNEIDESEDWQKGIYYALSASYALISLIALVLYFSLFLTVFLSCIF
BLAST of Cla012854 vs. Swiss-Prot
Match: TOM1_TOBAC (Tobamovirus multiplication protein 1 OS=Nicotiana tabacum GN=TOM1 PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 4.7e-06 Identity = 21/41 (51.22%), Postives = 28/41 (68.29%), Query Frame = 1
BLAST of Cla012854 vs. TrEMBL
Match: A0A0A0K5Z8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G062880 PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 9.6e-14 Identity = 40/48 (83.33%), Postives = 44/48 (91.67%), Query Frame = 1
BLAST of Cla012854 vs. TrEMBL
Match: A0A068TMH6_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00014792001 PE=4 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.5e-08 Identity = 28/43 (65.12%), Postives = 34/43 (79.07%), Query Frame = 1
BLAST of Cla012854 vs. TrEMBL
Match: D7TR60_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_12s0028g00460 PE=4 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.5e-08 Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 1
BLAST of Cla012854 vs. TrEMBL
Match: B9SIP7_RICCO (Virion binding protein, putative OS=Ricinus communis GN=RCOM_0824990 PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.1e-06 Identity = 25/41 (60.98%), Postives = 34/41 (82.93%), Query Frame = 1
BLAST of Cla012854 vs. TrEMBL
Match: A0A0R0IP73_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_08G072000 PE=4 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 1.9e-06 Identity = 22/37 (59.46%), Postives = 30/37 (81.08%), Query Frame = 1
BLAST of Cla012854 vs. NCBI nr
Match: gi|659110386|ref|XP_008455199.1| (PREDICTED: tobamovirus multiplication protein 1-like isoform X1 [Cucumis melo]) HSP 1 Score: 85.9 bits (211), Expect = 2.8e-14 Identity = 39/48 (81.25%), Postives = 43/48 (89.58%), Query Frame = 1
BLAST of Cla012854 vs. NCBI nr
Match: gi|449438197|ref|XP_004136876.1| (PREDICTED: tobamovirus multiplication protein 1-like isoform X1 [Cucumis sativus]) HSP 1 Score: 83.6 bits (205), Expect = 1.4e-13 Identity = 40/48 (83.33%), Postives = 44/48 (91.67%), Query Frame = 1
BLAST of Cla012854 vs. NCBI nr
Match: gi|661899452|emb|CDO97446.1| (unnamed protein product [Coffea canephora]) HSP 1 Score: 65.1 bits (157), Expect = 5.1e-08 Identity = 28/43 (65.12%), Postives = 34/43 (79.07%), Query Frame = 1
BLAST of Cla012854 vs. NCBI nr
Match: gi|296086834|emb|CBI32983.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 65.1 bits (157), Expect = 5.1e-08 Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 1
BLAST of Cla012854 vs. NCBI nr
Match: gi|731435294|ref|XP_002268725.2| (PREDICTED: tobamovirus multiplication protein 1-like [Vitis vinifera]) HSP 1 Score: 65.1 bits (157), Expect = 5.1e-08 Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|