Cla009023 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAGATCTCTTTTCTTCATTGTGTCTCTTCTCCTCTTTGTGTCGATGTTGTCGGTCACAGCAACAAGGTCACGGTTAGATTTGGTCGGTGGCTATGAACCAATAAAGAGCATAGATGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGTCTGGGACCAACTACGACCTTCGATTAATGGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCTAACTAA ATGGCTAGATCTCTTTTCTTCATTGTGTCTCTTCTCCTCTTTGTGTCGATGTTGTCGGTCACAGCAACAAGGTCACGGTTAGATTTGGTCGGTGGCTATGAACCAATAAAGAGCATAGATGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGTCTGGGACCAACTACGACCTTCGATTAATGGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCTAACTAA ATGGCTAGATCTCTTTTCTTCATTGTGTCTCTTCTCCTCTTTGTGTCGATGTTGTCGGTCACAGCAACAAGGTCACGGTTAGATTTGGTCGGTGGCTATGAACCAATAAAGAGCATAGATGATCCACATATCCAAAGCCTAGGAGAGTTTGCAGTGAATGAACACAATAAGCAAGCCAAAACTCAATTGAAATTCGAGAAAGTGATTAGTGGAAAATTACAGATTGTGTCTGGGACCAACTACGACCTTCGATTAATGGCTCTTGAGGGGACTGTAAGCAGAACCTATGGAACCCTTGTATTCACTGATCTAAAGAACGAGAACCATCTTATCAACTTCTATGGCCTCTCTAACTAA MARSLFFIVSLLLFVSMLSVTATRSRLDLVGGYEPIKSIDDPHIQSLGEFAVNEHNKQAKTQLKFEKVISGKLQIVSGTNYDLRLMALEGTVSRTYGTLVFTDLKNENHLINFYGLSN
BLAST of Cla009023 vs. Swiss-Prot
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana GN=CYS5 PE=2 SV=2) HSP 1 Score: 82.0 bits (201), Expect = 4.7e-15 Identity = 43/102 (42.16%), Postives = 68/102 (66.67%), Query Frame = 1
BLAST of Cla009023 vs. Swiss-Prot
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa PE=1 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.3e-12 Identity = 39/95 (41.05%), Postives = 59/95 (62.11%), Query Frame = 1
BLAST of Cla009023 vs. Swiss-Prot
Match: CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 41/100 (41.00%), Postives = 59/100 (59.00%), Query Frame = 1
BLAST of Cla009023 vs. Swiss-Prot
Match: CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana GN=CYS4 PE=3 SV=2) HSP 1 Score: 67.8 bits (164), Expect = 9.2e-11 Identity = 30/79 (37.97%), Postives = 50/79 (63.29%), Query Frame = 1
BLAST of Cla009023 vs. Swiss-Prot
Match: CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.0e-09 Identity = 36/83 (43.37%), Postives = 48/83 (57.83%), Query Frame = 1
BLAST of Cla009023 vs. TrEMBL
Match: A0A0A0LYM0_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G183070 PE=3 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 3.4e-44 Identity = 95/119 (79.83%), Postives = 107/119 (89.92%), Query Frame = 1
BLAST of Cla009023 vs. TrEMBL
Match: A0A0A0LT34_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus GN=Csa_1G182070 PE=3 SV=1) HSP 1 Score: 157.5 bits (397), Expect = 9.8e-36 Identity = 82/120 (68.33%), Postives = 99/120 (82.50%), Query Frame = 1
BLAST of Cla009023 vs. TrEMBL
Match: V4UQM2_9ROSI (Cysteine proteinase inhibitor OS=Citrus clementina GN=CICLE_v10009506mg PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.1e-15 Identity = 47/107 (43.93%), Postives = 71/107 (66.36%), Query Frame = 1
BLAST of Cla009023 vs. TrEMBL
Match: A0A067EPU7_CITSI (Cysteine proteinase inhibitor OS=Citrus sinensis GN=CISIN_1g037584mg PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.1e-15 Identity = 47/107 (43.93%), Postives = 71/107 (66.36%), Query Frame = 1
BLAST of Cla009023 vs. TrEMBL
Match: A5B2E1_VITVI (Cysteine proteinase inhibitor OS=Vitis vinifera GN=VITISV_013491 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 3.3e-15 Identity = 46/99 (46.46%), Postives = 64/99 (64.65%), Query Frame = 1
BLAST of Cla009023 vs. NCBI nr
Match: gi|449467076|ref|XP_004151251.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 185.7 bits (470), Expect = 4.8e-44 Identity = 95/119 (79.83%), Postives = 107/119 (89.92%), Query Frame = 1
BLAST of Cla009023 vs. NCBI nr
Match: gi|449467074|ref|XP_004151250.1| (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis sativus]) HSP 1 Score: 157.5 bits (397), Expect = 1.4e-35 Identity = 82/120 (68.33%), Postives = 99/120 (82.50%), Query Frame = 1
BLAST of Cla009023 vs. NCBI nr
Match: gi|568843169|ref|XP_006475490.1| (PREDICTED: cysteine proteinase inhibitor 5 [Citrus sinensis]) HSP 1 Score: 90.9 bits (224), Expect = 1.6e-15 Identity = 47/107 (43.93%), Postives = 71/107 (66.36%), Query Frame = 1
BLAST of Cla009023 vs. NCBI nr
Match: gi|567919020|ref|XP_006451516.1| (hypothetical protein CICLE_v10009506mg [Citrus clementina]) HSP 1 Score: 90.9 bits (224), Expect = 1.6e-15 Identity = 47/107 (43.93%), Postives = 71/107 (66.36%), Query Frame = 1
BLAST of Cla009023 vs. NCBI nr
Match: gi|147854421|emb|CAN82794.1| (hypothetical protein VITISV_013491 [Vitis vinifera]) HSP 1 Score: 89.4 bits (220), Expect = 4.7e-15 Identity = 46/99 (46.46%), Postives = 64/99 (64.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|