Cla008331 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCAAGCTTTATGAGTTCAGTAAAGTTTGATGTGGAAAAATTTGATGGAAGTGTCAACTTCGACTTGTGGCAAGTGCAAGCTAAGGATGTGTTGATACAAGCTTGGTTACACAAGGTCTTGAAGGGAAGACCAGGCAGTGGTGCTACTAAAGAGTTAAGTGATGATGATAGTCCAGGAAAGTCCAACGGTGGTTCCATTAAAGGTTCTAAGAAGTCCAGCATGAGCGATGAAGATTGGGAGGAGATGGATTTGAGAGCTGCAAGTGCGTTTAGGCTAAATTTGGTTAAGAATGTTCTTTCAAATGTGCATGGGATTTCAATAGCCAAAGAACTTTGGGAGCATCTTGAAGTAATGTATCAAGCAAAGAGCATCTCAAATTGA ATGTCAAGCTTTATGAGTTCAGTAAAGTTTGATGTGGAAAAATTTGATGGAAGTGTCAACTTCGACTTGTGGCAAGTGCAAGCTAAGGATGTGTTGATACAAGCTTGGTTACACAAGGTCTTGAAGGGAAGACCAGGCAGTGGTGCTACTAAAGAGTTAAGTGATGATGATAGTCCAGGAAAGTCCAACGGTGGTTCCATTAAAGGTTCTAAGAAGTCCAGCATGAGCGATGAAGATTGGGAGGAGATGGATTTGAGAGCTGCAAGTGCGTTTAGGCTAAATTTGGTTAAGAATGTTCTTTCAAATGTGCATGGGATTTCAATAGCCAAAGAACTTTGGGAGCATCTTGAAGTAATGTATCAAGCAAAGAGCATCTCAAATTGA ATGTCAAGCTTTATGAGTTCAGTAAAGTTTGATGTGGAAAAATTTGATGGAAGTGTCAACTTCGACTTGTGGCAAGTGCAAGCTAAGGATGTGTTGATACAAGCTTGGTTACACAAGGTCTTGAAGGGAAGACCAGGCAGTGGTGCTACTAAAGAGTTAAGTGATGATGATAGTCCAGGAAAGTCCAACGGTGGTTCCATTAAAGGTTCTAAGAAGTCCAGCATGAGCGATGAAGATTGGGAGGAGATGGATTTGAGAGCTGCAAGTGCGTTTAGGCTAAATTTGGTTAAGAATGTTCTTTCAAATGTGCATGGGATTTCAATAGCCAAAGAACTTTGGGAGCATCTTGAAGTAATGTATCAAGCAAAGAGCATCTCAAATTGA MSSFMSSVKFDVEKFDGSVNFDLWQVQAKDVLIQAWLHKVLKGRPGSGATKELSDDDSPGKSNGGSIKGSKKSSMSDEDWEEMDLRAASAFRLNLVKNVLSNVHGISIAKELWEHLEVMYQAKSISN
BLAST of Cla008331 vs. Swiss-Prot
Match: POLX_TOBAC (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 3.3e-14 Identity = 46/123 (37.40%), Postives = 65/123 (52.85%), Query Frame = 1
BLAST of Cla008331 vs. TrEMBL
Match: A0A0A0LQV2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G406750 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 1.1e-19 Identity = 57/112 (50.89%), Postives = 70/112 (62.50%), Query Frame = 1
BLAST of Cla008331 vs. TrEMBL
Match: V4T614_9ROSI (Uncharacterized protein (Fragment) OS=Citrus clementina GN=CICLE_v10023471mg PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 4.2e-16 Identity = 54/97 (55.67%), Postives = 63/97 (64.95%), Query Frame = 1
BLAST of Cla008331 vs. TrEMBL
Match: K4AWV4_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.1e-13 Identity = 47/123 (38.21%), Postives = 67/123 (54.47%), Query Frame = 1
BLAST of Cla008331 vs. TrEMBL
Match: K4CC58_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.5e-13 Identity = 48/123 (39.02%), Postives = 64/123 (52.03%), Query Frame = 1
BLAST of Cla008331 vs. TrEMBL
Match: K4B6D6_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.5e-13 Identity = 48/123 (39.02%), Postives = 65/123 (52.85%), Query Frame = 1
BLAST of Cla008331 vs. NCBI nr
Match: gi|700208058|gb|KGN63177.1| (hypothetical protein Csa_2G406750 [Cucumis sativus]) HSP 1 Score: 104.4 bits (259), Expect = 1.5e-19 Identity = 57/112 (50.89%), Postives = 70/112 (62.50%), Query Frame = 1
BLAST of Cla008331 vs. NCBI nr
Match: gi|567899860|ref|XP_006442418.1| (hypothetical protein CICLE_v10023471mg, partial [Citrus clementina]) HSP 1 Score: 92.4 bits (228), Expect = 6.0e-16 Identity = 54/97 (55.67%), Postives = 63/97 (64.95%), Query Frame = 1
BLAST of Cla008331 vs. NCBI nr
Match: gi|130582|sp|P10978.1|POLX_TOBAC (RecName: Full=Retrovirus-related Pol polyprotein from transposon TNT 1-94; Includes: RecName: Full=Protease; Includes: RecName: Full=Reverse transcriptase; Includes: RecName: Full=Endonuclease) HSP 1 Score: 79.3 bits (194), Expect = 5.2e-12 Identity = 46/123 (37.40%), Postives = 67/123 (54.47%), Query Frame = 1
BLAST of Cla008331 vs. NCBI nr
Match: gi|1012360036|gb|KYP71220.1| (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan]) HSP 1 Score: 79.3 bits (194), Expect = 5.2e-12 Identity = 49/124 (39.52%), Postives = 64/124 (51.61%), Query Frame = 1
BLAST of Cla008331 vs. NCBI nr
Match: gi|731361723|ref|XP_010692517.1| (PREDICTED: uncharacterized protein LOC104905624 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 79.3 bits (194), Expect = 5.2e-12 Identity = 46/120 (38.33%), Postives = 64/120 (53.33%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |