Cla007055 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAACCCAAGGTCAAGTTATCACTTGCAAAGGTACTCATTCCATATACCCATTTCATTCTTCCTCTCTATGCTTCACTTTTTCCAGCCACCGATCCTTTTGATTCAACTACCTTTGTTTCTTTCTCAGCGGCGGTGGCCTGGGAACCCAATAAGCCATTGGTGATCGAGGATGTTCAGGTGGCTCCGCCGCAAGCCGGCGAGGTCCGTGTCAAGATCCTCTACACTGCTCTTTGTCACACTGATGCTTATACCTGGAGTGGCAAGGTTGTTTTTCTTCTCTTCGATCTTCTAAATCCTTAA ATGGCAACCCAAGGTCAAGTTATCACTTGCAAAGCGGCGGTGGCCTGGGAACCCAATAAGCCATTGGTGATCGAGGATGTTCAGGTGGCTCCGCCGCAAGCCGGCGAGGTCCGTGTCAAGATCCTCTACACTGCTCTTTGTCACACTGATGCTTATACCTGGAGTGGCAAGGTTGTTTTTCTTCTCTTCGATCTTCTAAATCCTTAA ATGGCAACCCAAGGTCAAGTTATCACTTGCAAAGCGGCGGTGGCCTGGGAACCCAATAAGCCATTGGTGATCGAGGATGTTCAGGTGGCTCCGCCGCAAGCCGGCGAGGTCCGTGTCAAGATCCTCTACACTGCTCTTTGTCACACTGATGCTTATACCTGGAGTGGCAAGGTTGTTTTTCTTCTCTTCGATCTTCTAAATCCTTAA MATQGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVKILYTALCHTDAYTWSGKVVFLLFDLLNP
BLAST of Cla007055 vs. Swiss-Prot
Match: ADHX_ARATH (Alcohol dehydrogenase class-3 OS=Arabidopsis thaliana GN=ADH2 PE=1 SV=2) HSP 1 Score: 117.9 bits (294), Expect = 4.5e-26 Identity = 55/57 (96.49%), Postives = 55/57 (96.49%), Query Frame = 1
BLAST of Cla007055 vs. Swiss-Prot
Match: ADHX_MAIZE (Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 5.4e-24 Identity = 52/55 (94.55%), Postives = 52/55 (94.55%), Query Frame = 1
BLAST of Cla007055 vs. Swiss-Prot
Match: ADHX_ORYSI (Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. indica GN=ADHIII PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.6e-23 Identity = 50/56 (89.29%), Postives = 51/56 (91.07%), Query Frame = 1
BLAST of Cla007055 vs. Swiss-Prot
Match: ADHX_ORYSJ (Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. japonica GN=Os02g0815500 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 3.5e-23 Identity = 49/56 (87.50%), Postives = 51/56 (91.07%), Query Frame = 1
BLAST of Cla007055 vs. Swiss-Prot
Match: ADHX_PEA (Alcohol dehydrogenase class-3 OS=Pisum sativum PE=1 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 3.9e-22 Identity = 48/56 (85.71%), Postives = 50/56 (89.29%), Query Frame = 1
BLAST of Cla007055 vs. TrEMBL
Match: K4CU67_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.0e-25 Identity = 57/61 (93.44%), Postives = 59/61 (96.72%), Query Frame = 1
BLAST of Cla007055 vs. TrEMBL
Match: W9QX22_9ROSA (S-(hydroxymethyl)glutathione dehydrogenase OS=Morus notabilis GN=L484_015899 PE=3 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.0e-25 Identity = 58/73 (79.45%), Postives = 64/73 (87.67%), Query Frame = 1
BLAST of Cla007055 vs. TrEMBL
Match: A0A068U5I2_COFCA (S-(hydroxymethyl)glutathione dehydrogenase OS=Coffea canephora GN=GSCOC_T00016296001 PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 3.4e-25 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 1
BLAST of Cla007055 vs. TrEMBL
Match: A0A0A0KBZ1_CUCSA (S-(hydroxymethyl)glutathione dehydrogenase OS=Cucumis sativus GN=Csa_6G087920 PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 3.4e-25 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 1
BLAST of Cla007055 vs. TrEMBL
Match: E9ND19_9SOLN (S-(hydroxymethyl)glutathione dehydrogenase OS=Solanum chmielewskii GN=ADH3 PE=2 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 4.5e-25 Identity = 56/57 (98.25%), Postives = 57/57 (100.00%), Query Frame = 1
BLAST of Cla007055 vs. NCBI nr
Match: gi|703081968|ref|XP_010091830.1| (Alcohol dehydrogenase class-3 [Morus notabilis]) HSP 1 Score: 122.5 bits (306), Expect = 2.9e-25 Identity = 58/73 (79.45%), Postives = 64/73 (87.67%), Query Frame = 1
BLAST of Cla007055 vs. NCBI nr
Match: gi|449445644|ref|XP_004140582.1| (PREDICTED: alcohol dehydrogenase class-3 [Cucumis sativus]) HSP 1 Score: 121.7 bits (304), Expect = 4.9e-25 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 1
BLAST of Cla007055 vs. NCBI nr
Match: gi|661892652|emb|CDP03810.1| (unnamed protein product [Coffea canephora]) HSP 1 Score: 121.7 bits (304), Expect = 4.9e-25 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 1
BLAST of Cla007055 vs. NCBI nr
Match: gi|659120043|ref|XP_008459982.1| (PREDICTED: alcohol dehydrogenase class-3 [Cucumis melo]) HSP 1 Score: 121.7 bits (304), Expect = 4.9e-25 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 1
BLAST of Cla007055 vs. NCBI nr
Match: gi|353703786|ref|NP_001238796.1| (alcohol dehydrogenase class III [Solanum lycopersicum]) HSP 1 Score: 121.3 bits (303), Expect = 6.4e-25 Identity = 56/57 (98.25%), Postives = 57/57 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|