Cla007004 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGATGTTCTTCTCCAATTTTCTCATCACTCAATCTTCCAACAACACATCTTCCCTCATATTCAAAACTTGCAAAACCAGCTCTGACCAAGACCCCAACATCTCCTTCAATTTCTGCCTAACATCTCTTCAACCCGCCGCGTCCAAGCACCACCACGGCGCCACCAGTCTCCGCCGCCTCGGCCTCATTACCATCTACTTGATTAGACACAACATGAGCAGCACACGCCACCATATCAAGAAGTTGCGAAGAAACAAAGGCCTCACCGACCCGTTGGTTAAGTCGTGTTTGGCTGATTGTTTGGAGCTTTATTCCGATGCGATCCCGACGGTGAAGCAAGCGGGGAAGGATTACAAGGCCGGTCGATACGCCGACGCAAACTCGAAGATCAGCTCGGTTATGGATGATTGTTCAACATGTGAAGATGGATTCAAGGAGAAAGAAGGGGTGATTTCACCATTGACTAATAGAAATCATAATGCCTTTGAATTGTCGGCTATTGCACTGTCCATTATCAATATGCTTGCTTGA ATGTTGATGTTCTTCTCCAATTTTCTCATCACTCAATCTTCCAACAACACATCTTCCCTCATATTCAAAACTTGCAAAACCAGCTCTGACCAAGACCCCAACATCTCCTTCAATTTCTGCCTAACATCTCTTCAACCCGCCGCGTCCAAGCACCACCACGGCGCCACCAGTCTCCGCCGCCTCGGCCTCATTACCATCTACTTGATTAGACACAACATGAGCAGCACACGCCACCATATCAAGAAGTTGCGAAGAAACAAAGGCCTCACCGACCCGTTGGTTAAGTCGTGTTTGGCTGATTGTTTGGAGCTTTATTCCGATGCGATCCCGACGGTGAAGCAAGCGGGGAAGGATTACAAGGCCGGTCGATACGCCGACGCAAACTCGAAGATCAGCTCGGTTATGGATGATTGTTCAACATGTGAAGATGGATTCAAGGAGAAAGAAGGGGTGATTTCACCATTGACTAATAGAAATCATAATGCCTTTGAATTGTCGGCTATTGCACTGTCCATTATCAATATGCTTGCTTGA ATGTTGATGTTCTTCTCCAATTTTCTCATCACTCAATCTTCCAACAACACATCTTCCCTCATATTCAAAACTTGCAAAACCAGCTCTGACCAAGACCCCAACATCTCCTTCAATTTCTGCCTAACATCTCTTCAACCCGCCGCGTCCAAGCACCACCACGGCGCCACCAGTCTCCGCCGCCTCGGCCTCATTACCATCTACTTGATTAGACACAACATGAGCAGCACACGCCACCATATCAAGAAGTTGCGAAGAAACAAAGGCCTCACCGACCCGTTGGTTAAGTCGTGTTTGGCTGATTGTTTGGAGCTTTATTCCGATGCGATCCCGACGGTGAAGCAAGCGGGGAAGGATTACAAGGCCGGTCGATACGCCGACGCAAACTCGAAGATCAGCTCGGTTATGGATGATTGTTCAACATGTGAAGATGGATTCAAGGAGAAAGAAGGGGTGATTTCACCATTGACTAATAGAAATCATAATGCCTTTGAATTGTCGGCTATTGCACTGTCCATTATCAATATGCTTGCTTGA MLMFFSNFLITQSSNNTSSLIFKTCKTSSDQDPNISFNFCLTSLQPAASKHHHGATSLRRLGLITIYLIRHNMSSTRHHIKKLRRNKGLTDPLVKSCLADCLELYSDAIPTVKQAGKDYKAGRYADANSKISSVMDDCSTCEDGFKEKEGVISPLTNRNHNAFELSAIALSIINMLA
BLAST of Cla007004 vs. Swiss-Prot
Match: PLA1_PLAAC (Putative invertase inhibitor OS=Platanus acerifolia PE=1 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 4.7e-27 Identity = 64/176 (36.36%), Postives = 107/176 (60.80%), Query Frame = 1
BLAST of Cla007004 vs. Swiss-Prot
Match: PMEI_ACTDE (Pectinesterase inhibitor OS=Actinidia deliciosa GN=PMEI PE=1 SV=2) HSP 1 Score: 54.3 bits (129), Expect = 1.6e-06 Identity = 47/176 (26.70%), Postives = 77/176 (43.75%), Query Frame = 1
BLAST of Cla007004 vs. TrEMBL
Match: A0A0A0KBR8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G080370 PE=4 SV=1) HSP 1 Score: 303.5 bits (776), Expect = 1.7e-79 Identity = 153/179 (85.47%), Postives = 163/179 (91.06%), Query Frame = 1
BLAST of Cla007004 vs. TrEMBL
Match: E5GC99_CUCME (Invertase inhibitor OS=Cucumis melo subsp. melo PE=4 SV=1) HSP 1 Score: 300.8 bits (769), Expect = 1.1e-78 Identity = 149/178 (83.71%), Postives = 162/178 (91.01%), Query Frame = 1
BLAST of Cla007004 vs. TrEMBL
Match: A0A0A0K951_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G080380 PE=4 SV=1) HSP 1 Score: 205.7 bits (522), Expect = 4.7e-50 Identity = 111/177 (62.71%), Postives = 133/177 (75.14%), Query Frame = 1
BLAST of Cla007004 vs. TrEMBL
Match: A0A0D2PD74_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G168200 PE=4 SV=1) HSP 1 Score: 197.2 bits (500), Expect = 1.7e-47 Identity = 103/179 (57.54%), Postives = 132/179 (73.74%), Query Frame = 1
BLAST of Cla007004 vs. TrEMBL
Match: A0A061DWX5_THECC (Plant invertase/pectin methylesterase inhibitor superfamily protein OS=Theobroma cacao GN=TCM_005798 PE=4 SV=1) HSP 1 Score: 195.7 bits (496), Expect = 4.9e-47 Identity = 94/176 (53.41%), Postives = 131/176 (74.43%), Query Frame = 1
BLAST of Cla007004 vs. NCBI nr
Match: gi|449454566|ref|XP_004145025.1| (PREDICTED: putative invertase inhibitor [Cucumis sativus]) HSP 1 Score: 303.5 bits (776), Expect = 2.4e-79 Identity = 153/179 (85.47%), Postives = 163/179 (91.06%), Query Frame = 1
BLAST of Cla007004 vs. NCBI nr
Match: gi|307136270|gb|ADN34098.1| (invertase inhibitor [Cucumis melo subsp. melo]) HSP 1 Score: 300.8 bits (769), Expect = 1.5e-78 Identity = 149/178 (83.71%), Postives = 162/178 (91.01%), Query Frame = 1
BLAST of Cla007004 vs. NCBI nr
Match: gi|659120167|ref|XP_008460050.1| (PREDICTED: putative invertase inhibitor [Cucumis melo]) HSP 1 Score: 300.8 bits (769), Expect = 1.5e-78 Identity = 149/178 (83.71%), Postives = 162/178 (91.01%), Query Frame = 1
BLAST of Cla007004 vs. NCBI nr
Match: gi|659120165|ref|XP_008460048.1| (PREDICTED: putative invertase inhibitor [Cucumis melo]) HSP 1 Score: 208.4 bits (529), Expect = 1.0e-50 Identity = 111/177 (62.71%), Postives = 133/177 (75.14%), Query Frame = 1
BLAST of Cla007004 vs. NCBI nr
Match: gi|449454568|ref|XP_004145026.1| (PREDICTED: putative invertase inhibitor [Cucumis sativus]) HSP 1 Score: 205.7 bits (522), Expect = 6.8e-50 Identity = 111/177 (62.71%), Postives = 133/177 (75.14%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |