Cla006561 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCTGTGGACACTACTAGAGGGTTGTCTGCTTCTTGCTAACGCGCTGGCAATTCTGAATGAAGATCGCTTTCTTGCTCCTCGAGGATTGAACTTCTCTGAATTCTCAGGAGGCAGAACAAAGTCCTTCAAGGGGCAGCTTATTGGCCTTATCTACGCAACACAATATTTAAGAGTTCCTCTCATAATGCTAAATGCAATCTGTATCTTTGTAAAGTTAGTATCTGGATGA ATGGGTCTGTGGACACTACTAGAGGGTTGTCTGCTTCTTGCTAACGCGCTGGCAATTCTGAATGAAGATCGCTTTCTTGCTCCTCGAGGATTGAACTTCTCTGAATTCTCAGGAGGCAGAACAAAGTCCTTCAAGGGGCAGCTTATTGGCCTTATCTACGCAACACAATATTTAAGAGTTCCTCTCATAATGCTAAATGCAATCTGTATCTTTGTAAAGTTAGTATCTGGATGA ATGGGTCTGTGGACACTACTAGAGGGTTGTCTGCTTCTTGCTAACGCGCTGGCAATTCTGAATGAAGATCGCTTTCTTGCTCCTCGAGGATTGAACTTCTCTGAATTCTCAGGAGGCAGAACAAAGTCCTTCAAGGGGCAGCTTATTGGCCTTATCTACGCAACACAATATTTAAGAGTTCCTCTCATAATGCTAAATGCAATCTGTATCTTTGTAAAGTTAGTATCTGGATGA MGLWTLLEGCLLLANALAILNEDRFLAPRGLNFSEFSGGRTKSFKGQLIGLIYATQYLRVPLIMLNAICIFVKLVSG
BLAST of Cla006561 vs. Swiss-Prot
Match: IR3IP_XENLA (Immediate early response 3-interacting protein 1 OS=Xenopus laevis GN=ier3ip1 PE=3 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 3.4e-06 Identity = 31/78 (39.74%), Postives = 46/78 (58.97%), Query Frame = 1
BLAST of Cla006561 vs. Swiss-Prot
Match: IR3IP_DANRE (Immediate early response 3-interacting protein 1 OS=Danio rerio GN=ier3ip1 PE=3 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 4.4e-06 Identity = 29/78 (37.18%), Postives = 46/78 (58.97%), Query Frame = 1
BLAST of Cla006561 vs. Swiss-Prot
Match: IR3IP_BOVIN (Immediate early response 3-interacting protein 1 OS=Bos taurus GN=IER3IP1 PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 7.6e-06 Identity = 31/78 (39.74%), Postives = 46/78 (58.97%), Query Frame = 1
BLAST of Cla006561 vs. Swiss-Prot
Match: IR3IP_HUMAN (Immediate early response 3-interacting protein 1 OS=Homo sapiens GN=IER3IP1 PE=1 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 7.6e-06 Identity = 31/78 (39.74%), Postives = 46/78 (58.97%), Query Frame = 1
BLAST of Cla006561 vs. TrEMBL
Match: A0A0A0KBI3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G009360 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 4.1e-35 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 1
BLAST of Cla006561 vs. TrEMBL
Match: D7TMI4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_13s0019g03230 PE=4 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 4.3e-32 Identity = 70/77 (90.91%), Postives = 75/77 (97.40%), Query Frame = 1
BLAST of Cla006561 vs. TrEMBL
Match: A0A0D2V3B7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G074300 PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 4.7e-31 Identity = 70/77 (90.91%), Postives = 74/77 (96.10%), Query Frame = 1
BLAST of Cla006561 vs. TrEMBL
Match: A0A0B2Q8B8_GLYSO (Immediate early response 3-interacting protein 1 OS=Glycine soja GN=glysoja_017912 PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 6.2e-31 Identity = 70/77 (90.91%), Postives = 73/77 (94.81%), Query Frame = 1
BLAST of Cla006561 vs. TrEMBL
Match: A0A0B0P5F8_GOSAR (Immediate early response 3-interacting 1 OS=Gossypium arboreum GN=F383_09712 PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 6.2e-31 Identity = 70/77 (90.91%), Postives = 74/77 (96.10%), Query Frame = 1
BLAST of Cla006561 vs. NCBI nr
Match: gi|778709405|ref|XP_011656396.1| (PREDICTED: immediate early response 3-interacting protein 1-like [Cucumis sativus]) HSP 1 Score: 154.8 bits (390), Expect = 5.9e-35 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 1
BLAST of Cla006561 vs. NCBI nr
Match: gi|659081594|ref|XP_008441413.1| (PREDICTED: immediate early response 3-interacting protein 1-like [Cucumis melo]) HSP 1 Score: 154.5 bits (389), Expect = 7.8e-35 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 1
BLAST of Cla006561 vs. NCBI nr
Match: gi|802547017|ref|XP_012088078.1| (PREDICTED: immediate early response 3-interacting protein 1-like [Jatropha curcas]) HSP 1 Score: 145.6 bits (366), Expect = 3.6e-32 Identity = 72/77 (93.51%), Postives = 75/77 (97.40%), Query Frame = 1
BLAST of Cla006561 vs. NCBI nr
Match: gi|296086110|emb|CBI31551.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 144.8 bits (364), Expect = 6.2e-32 Identity = 70/77 (90.91%), Postives = 75/77 (97.40%), Query Frame = 1
BLAST of Cla006561 vs. NCBI nr
Match: gi|731412780|ref|XP_010658490.1| (PREDICTED: immediate early response 3-interacting protein 1-like [Vitis vinifera]) HSP 1 Score: 144.8 bits (364), Expect = 6.2e-32 Identity = 70/77 (90.91%), Postives = 75/77 (97.40%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |