Cla003418 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATCATCTCTACAAGGATCCACTGCAGTTGATTCTGATATAACTCCTCGTATCAAATTTAAGAGGCTTGATAAAACCTCAAGACACATAATGCAGGTATTCACATTTCTGAGTATTGTTGGAAAAGTAGTTTCATTTCATCTTCCATTTGTTTGCTTTCAATATATTGCTTTCTTTTCCCTACAGATTTTAGATAAGGAAGCTGTTGAGGAGGCAAAAGCACAAAGAGAAATTCCAGATATAAAGCCAGGCTATATTGTGCAGCTCAAAGTGGTAAAGTTCAGTCAAATTATTATCATGTTGCATTACTTTCAGATAATGTTCTTATTCTAAACAGCAGTTGTAGATGAGGTTATGGAACAGTTTTTTGGCTTTTCTTGTTATGTGTGAACAGGAAGTACCTGAGAACAAGCGGCGTGTCTCAACATTAAAAGGTATTGTAATAGCCAGAAGAAATGCTGGTCTCAACACAACTTTTAGATTAAGGAGGCTAGTTGCTGGTGTTGGGATTGAGTCCCTCTTCCCTCTGTAA ATGGAATCATCTCTACAAGGATCCACTGCAGTTGATTCTGATATAACTCCTCGTATCAAATTTAAGAGGCTTGATAAAACCTCAAGACACATAATGCAGATTTTAGATAAGGAAGCTGTTGAGGAGGCAAAAGCACAAAGAGAAATTCCAGATATAAAGCCAGGCTATATTGTGCAGCTCAAAGTGGAAGTACCTGAGAACAAGCGGCGTGTCTCAACATTAAAAGGTATTGTAATAGCCAGAAGAAATGCTGGTCTCAACACAACTTTTAGATTAAGGAGGCTAGTTGCTGGTGTTGGGATTGAGTCCCTCTTCCCTCTGTAA ATGGAATCATCTCTACAAGGATCCACTGCAGTTGATTCTGATATAACTCCTCGTATCAAATTTAAGAGGCTTGATAAAACCTCAAGACACATAATGCAGATTTTAGATAAGGAAGCTGTTGAGGAGGCAAAAGCACAAAGAGAAATTCCAGATATAAAGCCAGGCTATATTGTGCAGCTCAAAGTGGAAGTACCTGAGAACAAGCGGCGTGTCTCAACATTAAAAGGTATTGTAATAGCCAGAAGAAATGCTGGTCTCAACACAACTTTTAGATTAAGGAGGCTAGTTGCTGGTGTTGGGATTGAGTCCCTCTTCCCTCTGTAA MESSLQGSTAVDSDITPRIKFKRLDKTSRHIMQILDKEAVEEAKAQREIPDIKPGYIVQLKVEVPENKRRVSTLKGIVIARRNAGLNTTFRLRRLVAGVGIESLFPL
BLAST of Cla003418 vs. Swiss-Prot
Match: RK19_SPIOL (50S ribosomal protein L19, chloroplastic OS=Spinacia oleracea GN=RPL19 PE=1 SV=2) HSP 1 Score: 97.4 bits (241), Expect = 9.8e-20 Identity = 46/77 (59.74%), Postives = 62/77 (80.52%), Query Frame = 1
BLAST of Cla003418 vs. Swiss-Prot
Match: RK191_ARATH (50S ribosomal protein L19-1, chloroplastic OS=Arabidopsis thaliana GN=At4g17560 PE=2 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 4.9e-19 Identity = 41/77 (53.25%), Postives = 64/77 (83.12%), Query Frame = 1
BLAST of Cla003418 vs. Swiss-Prot
Match: RK192_ARATH (50S ribosomal protein L19-2, chloroplastic OS=Arabidopsis thaliana GN=At5g47190 PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 6.4e-19 Identity = 41/77 (53.25%), Postives = 63/77 (81.82%), Query Frame = 1
BLAST of Cla003418 vs. Swiss-Prot
Match: RL19_RHOCS (50S ribosomal protein L19 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplS PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 8.3e-11 Identity = 35/79 (44.30%), Postives = 52/79 (65.82%), Query Frame = 1
BLAST of Cla003418 vs. Swiss-Prot
Match: RL19_NOVAD (50S ribosomal protein L19 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplS PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.4e-10 Identity = 34/79 (43.04%), Postives = 51/79 (64.56%), Query Frame = 1
BLAST of Cla003418 vs. TrEMBL
Match: A0A0A0LV41_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G126060 PE=4 SV=1) HSP 1 Score: 190.3 bits (482), Expect = 1.2e-45 Identity = 97/107 (90.65%), Postives = 103/107 (96.26%), Query Frame = 1
BLAST of Cla003418 vs. TrEMBL
Match: I1N0B6_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_18G078700 PE=4 SV=2) HSP 1 Score: 174.9 bits (442), Expect = 5.4e-41 Identity = 87/107 (81.31%), Postives = 98/107 (91.59%), Query Frame = 1
BLAST of Cla003418 vs. TrEMBL
Match: F6GTR3_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_17s0000g09390 PE=4 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 9.2e-41 Identity = 88/107 (82.24%), Postives = 96/107 (89.72%), Query Frame = 1
BLAST of Cla003418 vs. TrEMBL
Match: I1KWY3_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_08G265900 PE=4 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 9.2e-41 Identity = 86/107 (80.37%), Postives = 98/107 (91.59%), Query Frame = 1
BLAST of Cla003418 vs. TrEMBL
Match: V4SZB9_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10022242mg PE=4 SV=1) HSP 1 Score: 173.7 bits (439), Expect = 1.2e-40 Identity = 87/107 (81.31%), Postives = 96/107 (89.72%), Query Frame = 1
BLAST of Cla003418 vs. NCBI nr
Match: gi|778659235|ref|XP_011654038.1| (PREDICTED: 50S ribosomal protein L19-2, chloroplastic isoform X1 [Cucumis sativus]) HSP 1 Score: 190.3 bits (482), Expect = 1.8e-45 Identity = 97/107 (90.65%), Postives = 103/107 (96.26%), Query Frame = 1
BLAST of Cla003418 vs. NCBI nr
Match: gi|778659241|ref|XP_011654048.1| (PREDICTED: 50S ribosomal protein L19-1, chloroplastic isoform X2 [Cucumis sativus]) HSP 1 Score: 190.3 bits (482), Expect = 1.8e-45 Identity = 97/107 (90.65%), Postives = 103/107 (96.26%), Query Frame = 1
BLAST of Cla003418 vs. NCBI nr
Match: gi|700209748|gb|KGN64844.1| (hypothetical protein Csa_1G126060 [Cucumis sativus]) HSP 1 Score: 190.3 bits (482), Expect = 1.8e-45 Identity = 97/107 (90.65%), Postives = 103/107 (96.26%), Query Frame = 1
BLAST of Cla003418 vs. NCBI nr
Match: gi|659071926|ref|XP_008462635.1| (PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like isoform X2 [Cucumis melo]) HSP 1 Score: 184.5 bits (467), Expect = 9.7e-44 Identity = 95/107 (88.79%), Postives = 100/107 (93.46%), Query Frame = 1
BLAST of Cla003418 vs. NCBI nr
Match: gi|659071924|ref|XP_008462626.1| (PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like isoform X1 [Cucumis melo]) HSP 1 Score: 184.5 bits (467), Expect = 9.7e-44 Identity = 95/107 (88.79%), Postives = 100/107 (93.46%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|