Cla003058 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGATTGTTGTAGCGGTGTCTCTTTTGATATTGCCGCTTGTGCTGCCGCCGTTGCCGCCCCCACCGGTGCTGCTGCTGTTTGTTCCGGTGTTGATTATGTCGTTGCTTCTGTTCTTGGCGCTGTCGCCGTCACAGGTTCCGGCGGAGGAGCACTGTGTGGCTGACGGCGGCGACGGTCACAATTCGGCTTGA ATGTTGATTGTTGTAGCGGTGTCTCTTTTGATATTGCCGCTTGTGCTGCCGCCGTTGCCGCCCCCACCGGTGCTGCTGCTGTTTGTTCCGGTGTTGATTATGTCGTTGCTTCTGTTCTTGGCGCTGTCGCCGTCACAGGTTCCGGCGGAGGAGCACTGTGTGGCTGACGGCGGCGACGGTCACAATTCGGCTTGA ATGTTGATTGTTGTAGCGGTGTCTCTTTTGATATTGCCGCTTGTGCTGCCGCCGTTGCCGCCCCCACCGGTGCTGCTGCTGTTTGTTCCGGTGTTGATTATGTCGTTGCTTCTGTTCTTGGCGCTGTCGCCGTCACAGGTTCCGGCGGAGGAGCACTGTGTGGCTGACGGCGGCGACGGTCACAATTCGGCTTGA MLIVVAVSLLILPLVLPPLPPPPVLLLFVPVLIMSLLLFLALSPSQVPAEEHCVADGGDGHNSA
BLAST of Cla003058 vs. Swiss-Prot
Match: ARGOS_ORYSJ (Protein AUXIN-REGULATED GENE INVOLVED IN ORGAN SIZE OS=Oryza sativa subsp. japonica GN=ARGOS PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.1e-10 Identity = 32/64 (50.00%), Postives = 39/64 (60.94%), Query Frame = 1
BLAST of Cla003058 vs. Swiss-Prot
Match: ORS1_ARATH (Protein ORGAN SIZE RELATED 1 OS=Arabidopsis thaliana GN=ORS1 PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.7e-09 Identity = 28/49 (57.14%), Postives = 36/49 (73.47%), Query Frame = 1
BLAST of Cla003058 vs. Swiss-Prot
Match: ARGOS_BRARP (Protein AUXIN-REGULATED GENE INVOLVED IN ORGAN SIZE OS=Brassica rapa subsp. pekinensis GN=ARGOS PE=2 SV=2) HSP 1 Score: 60.5 bits (145), Expect = 7.9e-09 Identity = 29/45 (64.44%), Postives = 33/45 (73.33%), Query Frame = 1
BLAST of Cla003058 vs. Swiss-Prot
Match: ARGOS_ARATH (Protein AUXIN-REGULATED GENE INVOLVED IN ORGAN SIZE OS=Arabidopsis thaliana GN=ARGOS PE=2 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.0e-08 Identity = 29/45 (64.44%), Postives = 33/45 (73.33%), Query Frame = 1
BLAST of Cla003058 vs. Swiss-Prot
Match: ARL_ARATH (ARGOS-like protein OS=Arabidopsis thaliana GN=ARL PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 1.8e-08 Identity = 27/45 (60.00%), Postives = 33/45 (73.33%), Query Frame = 1
BLAST of Cla003058 vs. TrEMBL
Match: A0A0A0L0Y7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G432970 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 3.3e-22 Identity = 58/64 (90.62%), Postives = 59/64 (92.19%), Query Frame = 1
BLAST of Cla003058 vs. TrEMBL
Match: U5G5G3_POPTR (Uncharacterized protein (Fragment) OS=Populus trichocarpa GN=POPTR_0006s03610g PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.7e-11 Identity = 34/48 (70.83%), Postives = 44/48 (91.67%), Query Frame = 1
BLAST of Cla003058 vs. TrEMBL
Match: U5G936_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0006s03620g PE=4 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.2e-10 Identity = 34/45 (75.56%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cla003058 vs. TrEMBL
Match: A0A068UM56_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00028963001 PE=4 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 3.8e-10 Identity = 32/51 (62.75%), Postives = 44/51 (86.27%), Query Frame = 1
BLAST of Cla003058 vs. TrEMBL
Match: U5G904_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0006s03640g PE=4 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 5.0e-10 Identity = 30/48 (62.50%), Postives = 44/48 (91.67%), Query Frame = 1
BLAST of Cla003058 vs. NCBI nr
Match: gi|700199561|gb|KGN54719.1| (hypothetical protein Csa_4G432970 [Cucumis sativus]) HSP 1 Score: 111.7 bits (278), Expect = 4.8e-22 Identity = 58/64 (90.62%), Postives = 59/64 (92.19%), Query Frame = 1
BLAST of Cla003058 vs. NCBI nr
Match: gi|566174294|ref|XP_006380976.1| (hypothetical protein POPTR_0006s03610g, partial [Populus trichocarpa]) HSP 1 Score: 75.5 bits (184), Expect = 3.8e-11 Identity = 34/48 (70.83%), Postives = 44/48 (91.67%), Query Frame = 1
BLAST of Cla003058 vs. NCBI nr
Match: gi|566174296|ref|XP_006380977.1| (hypothetical protein POPTR_0006s03620g [Populus trichocarpa]) HSP 1 Score: 72.4 bits (176), Expect = 3.2e-10 Identity = 34/45 (75.56%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cla003058 vs. NCBI nr
Match: gi|661886828|emb|CDP09546.1| (unnamed protein product [Coffea canephora]) HSP 1 Score: 71.6 bits (174), Expect = 5.5e-10 Identity = 32/51 (62.75%), Postives = 44/51 (86.27%), Query Frame = 1
BLAST of Cla003058 vs. NCBI nr
Match: gi|566174300|ref|XP_006380979.1| (hypothetical protein POPTR_0006s03640g [Populus trichocarpa]) HSP 1 Score: 71.2 bits (173), Expect = 7.2e-10 Identity = 30/48 (62.50%), Postives = 44/48 (91.67%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|