Cla003054 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCTTTCGTCGTTGACAAGTCGTTTCATAGGCAGATATCGCAACAAAGAGGAATATTGGAAATTGATCAACAGCTTGCTTTGGATCCATTGACAAAGGACTTCGTATGGAATGTGGCGTTCCGATCCGACTTCGCCTTCAAGTTTGGACAAGCATTGATCAAGATGGGAAGAATTCAAGTTCTTACTGGCTCAGAAGGGGAGATTAGAAGAACATGTGGGGCTGTTAATTGA ATGAGTTCTTTCGTCGTTGACAAGTCGTTTCATAGGCAGATATCGCAACAAAGAGGAATATTGGAAATTGATCAACAGCTTGCTTTGGATCCATTGACAAAGGACTTCGTATGGAATGTGGCGTTCCGATCCGACTTCGCCTTCAAGTTTGGACAAGCATTGATCAAGATGGGAAGAATTCAAGTTCTTACTGGCTCAGAAGGGGAGATTAGAAGAACATGTGGGGCTGTTAATTGA ATGAGTTCTTTCGTCGTTGACAAGTCGTTTCATAGGCAGATATCGCAACAAAGAGGAATATTGGAAATTGATCAACAGCTTGCTTTGGATCCATTGACAAAGGACTTCGTATGGAATGTGGCGTTCCGATCCGACTTCGCCTTCAAGTTTGGACAAGCATTGATCAAGATGGGAAGAATTCAAGTTCTTACTGGCTCAGAAGGGGAGATTAGAAGAACATGTGGGGCTGTTAATTGA MSSFVVDKSFHRQISQQRGILEIDQQLALDPLTKDFVWNVAFRSDFAFKFGQALIKMGRIQVLTGSEGEIRRTCGAVN
BLAST of Cla003054 vs. Swiss-Prot
Match: PER60_ARATH (Peroxidase 60 OS=Arabidopsis thaliana GN=PER60 PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.2e-11 Identity = 33/74 (44.59%), Postives = 51/74 (68.92%), Query Frame = 1
BLAST of Cla003054 vs. Swiss-Prot
Match: PER44_ARATH (Peroxidase 44 OS=Arabidopsis thaliana GN=PER44 PE=2 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.1e-11 Identity = 38/78 (48.72%), Postives = 46/78 (58.97%), Query Frame = 1
BLAST of Cla003054 vs. Swiss-Prot
Match: PER57_ARATH (Peroxidase 57 OS=Arabidopsis thaliana GN=PER57 PE=1 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.0e-10 Identity = 35/74 (47.30%), Postives = 46/74 (62.16%), Query Frame = 1
BLAST of Cla003054 vs. Swiss-Prot
Match: PER71_ARATH (Peroxidase 71 OS=Arabidopsis thaliana GN=PER71 PE=1 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 8.8e-10 Identity = 32/73 (43.84%), Postives = 46/73 (63.01%), Query Frame = 1
BLAST of Cla003054 vs. Swiss-Prot
Match: PER8_ARATH (Peroxidase 8 OS=Arabidopsis thaliana GN=PER8 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 4.3e-09 Identity = 35/76 (46.05%), Postives = 41/76 (53.95%), Query Frame = 1
BLAST of Cla003054 vs. TrEMBL
Match: A0A0A0LYA7_CUCSA (Peroxidase OS=Cucumis sativus GN=Csa_1G166260 PE=3 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 2.2e-28 Identity = 66/78 (84.62%), Postives = 69/78 (88.46%), Query Frame = 1
BLAST of Cla003054 vs. TrEMBL
Match: A0A022QDF1_ERYGU (Peroxidase OS=Erythranthe guttata GN=MIMGU_mgv1a024318mg PE=3 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 8.0e-18 Identity = 47/78 (60.26%), Postives = 61/78 (78.21%), Query Frame = 1
BLAST of Cla003054 vs. TrEMBL
Match: A0A061GV76_THECC (Peroxidase OS=Theobroma cacao GN=TCM_041378 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.3e-17 Identity = 44/78 (56.41%), Postives = 61/78 (78.21%), Query Frame = 1
BLAST of Cla003054 vs. TrEMBL
Match: A0A124SBH4_CYNCS (Peroxidase OS=Cynara cardunculus var. scolymus GN=Ccrd_007322 PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 4.4e-16 Identity = 46/78 (58.97%), Postives = 60/78 (76.92%), Query Frame = 1
BLAST of Cla003054 vs. TrEMBL
Match: A0A124SBH4_CYNCS (Peroxidase OS=Cynara cardunculus var. scolymus GN=Ccrd_007322 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.3e-15 Identity = 45/77 (58.44%), Postives = 60/77 (77.92%), Query Frame = 1
HSP 2 Score: 91.7 bits (226), Expect = 4.4e-16 Identity = 46/79 (58.23%), Postives = 63/79 (79.75%), Query Frame = 1
BLAST of Cla003054 vs. NCBI nr
Match: gi|659071650|ref|XP_008461222.1| (PREDICTED: peroxidase 60-like [Cucumis melo]) HSP 1 Score: 132.9 bits (333), Expect = 2.5e-28 Identity = 66/78 (84.62%), Postives = 70/78 (89.74%), Query Frame = 1
BLAST of Cla003054 vs. NCBI nr
Match: gi|700209850|gb|KGN64946.1| (hypothetical protein Csa_1G166260 [Cucumis sativus]) HSP 1 Score: 132.5 bits (332), Expect = 3.2e-28 Identity = 66/78 (84.62%), Postives = 69/78 (88.46%), Query Frame = 1
BLAST of Cla003054 vs. NCBI nr
Match: gi|778664996|ref|XP_011648460.1| (PREDICTED: peroxidase 60 [Cucumis sativus]) HSP 1 Score: 132.5 bits (332), Expect = 3.2e-28 Identity = 66/78 (84.62%), Postives = 69/78 (88.46%), Query Frame = 1
BLAST of Cla003054 vs. NCBI nr
Match: gi|604313391|gb|EYU26722.1| (hypothetical protein MIMGU_mgv1a024318mg [Erythranthe guttata]) HSP 1 Score: 97.4 bits (241), Expect = 1.1e-17 Identity = 47/78 (60.26%), Postives = 61/78 (78.21%), Query Frame = 1
BLAST of Cla003054 vs. NCBI nr
Match: gi|848900035|ref|XP_012850166.1| (PREDICTED: peroxidase 60 [Erythranthe guttata]) HSP 1 Score: 97.4 bits (241), Expect = 1.1e-17 Identity = 47/78 (60.26%), Postives = 61/78 (78.21%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|