Cla002273 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATCCGCCAACCCAGAATACTTCGTTGCAACGCCTTCAAAATGTGGAGAAGGTTGGAACTATTTCCATACCAAAAGCTTTTTGTTTCTAGTTCTTTGGATGGTCTTTATTGTAGCACGATATTCTTTTTGGCCAACTTTTGTGTTTCACTCCTGCAGAGAATTGTGAGAGTTTTGGAGCTAGCGGGAGGAGTCATGGAAGAGCTTGCCAACCCTGCTGGTCCAAGAAAGGAATTTGTCAACAATCATTGCAGTGAGTTCATGCAATTCATCAAGGTGAGCCCTCTGTGTTTGACAGTGGTTCTTATATGA ATGGATCCGCCAACCCAGAATACTTCGTTGCAACGCCTTCAAAATGTGGAGAAGAGAATTGTGAGAGTTTTGGAGCTAGCGGGAGGAGTCATGGAAGAGCTTGCCAACCCTGCTGGTCCAAGAAAGGAATTTGTCAACAATCATTGCAGTGAGTTCATGCAATTCATCAAGGTGAGCCCTCTGTGTTTGACAGTGGTTCTTATATGA ATGGATCCGCCAACCCAGAATACTTCGTTGCAACGCCTTCAAAATGTGGAGAAGAGAATTGTGAGAGTTTTGGAGCTAGCGGGAGGAGTCATGGAAGAGCTTGCCAACCCTGCTGGTCCAAGAAAGGAATTTGTCAACAATCATTGCAGTGAGTTCATGCAATTCATCAAGGTGAGCCCTCTGTGTTTGACAGTGGTTCTTATATGA MDPPTQNTSLQRLQNVEKRIVRVLELAGGVMEELANPAGPRKEFVNNHCSEFMQFIKVSPLCLTVVLI
BLAST of Cla002273 vs. Swiss-Prot
Match: MED11_ARATH (Mediator of RNA polymerase II transcription subunit 11 OS=Arabidopsis thaliana GN=MED11 PE=1 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 1.6e-20 Identity = 46/57 (80.70%), Postives = 51/57 (89.47%), Query Frame = 1
BLAST of Cla002273 vs. TrEMBL
Match: A0A0A0L450_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G594450 PE=4 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 5.5e-23 Identity = 55/57 (96.49%), Postives = 55/57 (96.49%), Query Frame = 1
BLAST of Cla002273 vs. TrEMBL
Match: A0A061GG64_THECC (Mediator of RNA polymerase II transcription subunit 11 OS=Theobroma cacao GN=TCM_030340 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.5e-20 Identity = 50/57 (87.72%), Postives = 53/57 (92.98%), Query Frame = 1
BLAST of Cla002273 vs. TrEMBL
Match: A0A0B0N6V2_GOSAR (Mediator of RNA polymerase II transcription subunit 11 OS=Gossypium arboreum GN=F383_14611 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.5e-20 Identity = 50/57 (87.72%), Postives = 53/57 (92.98%), Query Frame = 1
BLAST of Cla002273 vs. TrEMBL
Match: W9R6A2_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_026253 PE=4 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 2.5e-20 Identity = 51/57 (89.47%), Postives = 53/57 (92.98%), Query Frame = 1
BLAST of Cla002273 vs. TrEMBL
Match: M1C635_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400023560 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 4.3e-20 Identity = 49/57 (85.96%), Postives = 54/57 (94.74%), Query Frame = 1
BLAST of Cla002273 vs. NCBI nr
Match: gi|659082827|ref|XP_008442051.1| (PREDICTED: mediator of RNA polymerase II transcription subunit 11 [Cucumis melo]) HSP 1 Score: 116.3 bits (290), Expect = 2.1e-23 Identity = 56/57 (98.25%), Postives = 56/57 (98.25%), Query Frame = 1
BLAST of Cla002273 vs. NCBI nr
Match: gi|449453808|ref|XP_004144648.1| (PREDICTED: mediator of RNA polymerase II transcription subunit 11 [Cucumis sativus]) HSP 1 Score: 114.4 bits (285), Expect = 7.9e-23 Identity = 55/57 (96.49%), Postives = 55/57 (96.49%), Query Frame = 1
BLAST of Cla002273 vs. NCBI nr
Match: gi|700199753|gb|KGN54911.1| (hypothetical protein Csa_4G594450 [Cucumis sativus]) HSP 1 Score: 114.4 bits (285), Expect = 7.9e-23 Identity = 55/57 (96.49%), Postives = 55/57 (96.49%), Query Frame = 1
BLAST of Cla002273 vs. NCBI nr
Match: gi|590626684|ref|XP_007026238.1| (Mediator of RNA polymerase II transcription subunit 11 [Theobroma cacao]) HSP 1 Score: 106.3 bits (264), Expect = 2.1e-20 Identity = 50/57 (87.72%), Postives = 53/57 (92.98%), Query Frame = 1
BLAST of Cla002273 vs. NCBI nr
Match: gi|728830775|gb|KHG10218.1| (Mediator of RNA polymerase II transcription subunit 11 [Gossypium arboreum]) HSP 1 Score: 106.3 bits (264), Expect = 2.1e-20 Identity = 50/57 (87.72%), Postives = 53/57 (92.98%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|