Cla001864 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCACCAAAGGCCGAGAAGAAGCCAACGGCGGAGGAGAAGAAGTCTGAGAAGGCTCTAGTGGAGAAGAAGCTGAGAGCCGAGAAGAAACTTCCCAAAGACGTCTCTGATAAGAAGAAGAAGAAGAAGGCTAAGAAGAGCGTTGAGACTTACAAGATCTACATCTTCAAGGTGCTCAAGCAAGTCCATCCTGACATTGGAATCTCCAACGAAGCCATGGGGATTATGAACAGTTTCATCAACGACATTTTTTAA ATGGCACCAAAGGCCGAGAAGAAGCCAACGGCGGAGGAGAAGAAGTCTGAGAAGGCTCTAGTGGAGAAGAAGCTGAGAGCCGAGAAGAAACTTCCCAAAGACGTCTCTGATAAGAAGAAGAAGAAGAAGGCTAAGAAGAGCGTTGAGACTTACAAGATCTACATCTTCAAGGTGCTCAAGCAAGTCCATCCTGACATTGGAATCTCCAACGAAGCCATGGGGATTATGAACAGTTTCATCAACGACATTTTTTAA ATGGCACCAAAGGCCGAGAAGAAGCCAACGGCGGAGGAGAAGAAGTCTGAGAAGGCTCTAGTGGAGAAGAAGCTGAGAGCCGAGAAGAAACTTCCCAAAGACGTCTCTGATAAGAAGAAGAAGAAGAAGGCTAAGAAGAGCGTTGAGACTTACAAGATCTACATCTTCAAGGTGCTCAAGCAAGTCCATCCTGACATTGGAATCTCCAACGAAGCCATGGGGATTATGAACAGTTTCATCAACGACATTTTTTAA MAPKAEKKPTAEEKKSEKALVEKKLRAEKKLPKDVSDKKKKKKAKKSVETYKIYIFKVLKQVHPDIGISNEAMGIMNSFINDIF
BLAST of Cla001864 vs. Swiss-Prot
Match: H2B1_SOLLC (Histone H2B.1 OS=Solanum lycopersicum GN=H2B-1 PE=2 SV=4) HSP 1 Score: 124.8 bits (312), Expect = 4.5e-28 Identity = 65/88 (73.86%), Postives = 71/88 (80.68%), Query Frame = 1
BLAST of Cla001864 vs. Swiss-Prot
Match: H2B2_MEDTR (Probable histone H2B.2 OS=Medicago truncatula PE=3 SV=3) HSP 1 Score: 120.9 bits (302), Expect = 6.5e-27 Identity = 68/94 (72.34%), Postives = 74/94 (78.72%), Query Frame = 1
BLAST of Cla001864 vs. Swiss-Prot
Match: H2B1_MEDTR (Probable histone H2B.1 OS=Medicago truncatula PE=3 SV=3) HSP 1 Score: 120.9 bits (302), Expect = 6.5e-27 Identity = 68/94 (72.34%), Postives = 74/94 (78.72%), Query Frame = 1
BLAST of Cla001864 vs. Swiss-Prot
Match: H2B3_MEDTR (Probable histone H2B.3 OS=Medicago truncatula PE=3 SV=3) HSP 1 Score: 120.9 bits (302), Expect = 6.5e-27 Identity = 62/81 (76.54%), Postives = 70/81 (86.42%), Query Frame = 1
BLAST of Cla001864 vs. Swiss-Prot
Match: H2B_GOSHI (Histone H2B OS=Gossypium hirsutum GN=HIS2B PE=2 SV=3) HSP 1 Score: 120.6 bits (301), Expect = 8.5e-27 Identity = 68/93 (73.12%), Postives = 73/93 (78.49%), Query Frame = 1
BLAST of Cla001864 vs. TrEMBL
Match: A0A0A0LV55_CUCSA (Histone H2B OS=Cucumis sativus GN=Csa_1G132130 PE=3 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.3e-29 Identity = 73/89 (82.02%), Postives = 78/89 (87.64%), Query Frame = 1
BLAST of Cla001864 vs. TrEMBL
Match: A0A0A0LST8_CUCSA (Histone H2B OS=Cucumis sativus GN=Csa_1G132680 PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 3.7e-29 Identity = 72/89 (80.90%), Postives = 77/89 (86.52%), Query Frame = 1
BLAST of Cla001864 vs. TrEMBL
Match: A0A0D2SV51_GOSRA (Histone H2B OS=Gossypium raimondii GN=B456_006G104400 PE=3 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.8e-28 Identity = 70/88 (79.55%), Postives = 77/88 (87.50%), Query Frame = 1
BLAST of Cla001864 vs. TrEMBL
Match: A0A0D2NPV9_GOSRA (Histone H2B OS=Gossypium raimondii GN=B456_006G104600 PE=3 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 4.1e-28 Identity = 69/88 (78.41%), Postives = 77/88 (87.50%), Query Frame = 1
BLAST of Cla001864 vs. TrEMBL
Match: A0A0D2S0C9_GOSRA (Histone H2B OS=Gossypium raimondii GN=B456_006G104500 PE=3 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 4.1e-28 Identity = 69/88 (78.41%), Postives = 77/88 (87.50%), Query Frame = 1
BLAST of Cla001864 vs. TAIR10
Match: AT3G46030.1 (AT3G46030.1 Histone superfamily protein) HSP 1 Score: 118.6 bits (296), Expect = 1.8e-27 Identity = 67/92 (72.83%), Postives = 71/92 (77.17%), Query Frame = 1
BLAST of Cla001864 vs. TAIR10
Match: AT3G53650.1 (AT3G53650.1 Histone superfamily protein) HSP 1 Score: 118.2 bits (295), Expect = 2.4e-27 Identity = 59/84 (70.24%), Postives = 68/84 (80.95%), Query Frame = 1
BLAST of Cla001864 vs. TAIR10
Match: AT2G37470.1 (AT2G37470.1 Histone superfamily protein) HSP 1 Score: 117.5 bits (293), Expect = 4.0e-27 Identity = 61/85 (71.76%), Postives = 68/85 (80.00%), Query Frame = 1
BLAST of Cla001864 vs. TAIR10
Match: AT5G59910.1 (AT5G59910.1 Histone superfamily protein) HSP 1 Score: 116.7 bits (291), Expect = 6.9e-27 Identity = 67/97 (69.07%), Postives = 71/97 (73.20%), Query Frame = 1
BLAST of Cla001864 vs. TAIR10
Match: AT1G07790.1 (AT1G07790.1 Histone superfamily protein) HSP 1 Score: 116.3 bits (290), Expect = 9.0e-27 Identity = 62/94 (65.96%), Postives = 69/94 (73.40%), Query Frame = 1
BLAST of Cla001864 vs. NCBI nr
Match: gi|778659255|ref|XP_011654070.1| (PREDICTED: histone H2B.7 [Cucumis sativus]) HSP 1 Score: 136.7 bits (343), Expect = 1.8e-29 Identity = 73/89 (82.02%), Postives = 78/89 (87.64%), Query Frame = 1
BLAST of Cla001864 vs. NCBI nr
Match: gi|449443375|ref|XP_004139453.1| (PREDICTED: histone H2B.7-like [Cucumis sativus]) HSP 1 Score: 135.2 bits (339), Expect = 5.3e-29 Identity = 72/89 (80.90%), Postives = 77/89 (86.52%), Query Frame = 1
BLAST of Cla001864 vs. NCBI nr
Match: gi|657986724|ref|XP_008385496.1| (PREDICTED: probable histone H2B.1 [Malus domestica]) HSP 1 Score: 134.0 bits (336), Expect = 1.2e-28 Identity = 69/88 (78.41%), Postives = 77/88 (87.50%), Query Frame = 1
BLAST of Cla001864 vs. NCBI nr
Match: gi|823172029|ref|XP_012484994.1| (PREDICTED: histone H2B-like [Gossypium raimondii]) HSP 1 Score: 132.9 bits (333), Expect = 2.6e-28 Identity = 70/88 (79.55%), Postives = 77/88 (87.50%), Query Frame = 1
BLAST of Cla001864 vs. NCBI nr
Match: gi|694332634|ref|XP_009356943.1| (PREDICTED: probable histone H2B.1 [Pyrus x bretschneideri]) HSP 1 Score: 132.9 bits (333), Expect = 2.6e-28 Identity = 69/88 (78.41%), Postives = 77/88 (87.50%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|