Cla001753 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTGTAGGGAGGGACTTATGTCACCACAAACAGAGACTAAAGCAAGTGTTGGATTCAAACCTGGTGTTAAAGATTCTAAATTGACTTATTCGACTCCTGAATATGAAACCAAAGATACTGATATCTTGGCAGCATTCCGAGTAACTCCTCAACCGGGAGTTCCACCTGAGGAAGCAGGGGCCGCTGTAGCTGCTGAATCTTCTACTGGTACATGGACAACTGTGTGGACCGATGGGCTTACCAGTCTTGATCGTTACAAAGGACGATGCTATGGAATCGAGCCTGTTCCTGGAGAAGAAAATCAATATATTGCTTATGTAGCTTATCCCCTAGACCTTTTTTAA ATGAGTTGTAGGGAGGGACTTATGTCACCACAAACAGAGACTAAAGCAAGTGTTGGATTCAAACCTGGTGTTAAAGATTCTAAATTGACTTATTCGACTCCTGAATATGAAACCAAAGATACTGATATCTTGGCAGCATTCCGAGTAACTCCTCAACCGGGAGTTCCACCTGAGGAAGCAGGGGCCGCTGTAGCTGCTGAATCTTCTACTGGTACATGGACAACTGTGTGGACCGATGGGCTTACCAGTCTTGATCGTTACAAAGGACGATGCTATGGAATCGAGCCTGTTCCTGGAGAAGAAAATCAATATATTGCTTATGTAGCTTATCCCCTAGACCTTTTTTAA ATGAGTTGTAGGGAGGGACTTATGTCACCACAAACAGAGACTAAAGCAAGTGTTGGATTCAAACCTGGTGTTAAAGATTCTAAATTGACTTATTCGACTCCTGAATATGAAACCAAAGATACTGATATCTTGGCAGCATTCCGAGTAACTCCTCAACCGGGAGTTCCACCTGAGGAAGCAGGGGCCGCTGTAGCTGCTGAATCTTCTACTGGTACATGGACAACTGTGTGGACCGATGGGCTTACCAGTCTTGATCGTTACAAAGGACGATGCTATGGAATCGAGCCTGTTCCTGGAGAAGAAAATCAATATATTGCTTATGTAGCTTATCCCCTAGACCTTTTTTAA MSCREGLMSPQTETKASVGFKPGVKDSKLTYSTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGIEPVPGEENQYIAYVAYPLDLF
BLAST of Cla001753 vs. Swiss-Prot
Match: RBL_CICIN (Ribulose bisphosphate carboxylase large chain OS=Cichorium intybus GN=rbcL PE=3 SV=1) HSP 1 Score: 218.4 bits (555), Expect = 4.1e-56 Identity = 105/108 (97.22%), Postives = 103/108 (95.37%), Query Frame = 1
BLAST of Cla001753 vs. Swiss-Prot
Match: RBL_LACSA (Ribulose bisphosphate carboxylase large chain OS=Lactuca sativa GN=rbcL PE=3 SV=2) HSP 1 Score: 218.4 bits (555), Expect = 4.1e-56 Identity = 105/108 (97.22%), Postives = 103/108 (95.37%), Query Frame = 1
BLAST of Cla001753 vs. Swiss-Prot
Match: RBL_BARSO (Ribulose bisphosphate carboxylase large chain OS=Bartlettina sordida GN=rbcL PE=3 SV=1) HSP 1 Score: 217.2 bits (552), Expect = 9.1e-56 Identity = 104/108 (96.30%), Postives = 103/108 (95.37%), Query Frame = 1
BLAST of Cla001753 vs. Swiss-Prot
Match: RBL_FLABI (Ribulose bisphosphate carboxylase large chain OS=Flaveria bidentis GN=rbcL PE=3 SV=1) HSP 1 Score: 217.2 bits (552), Expect = 9.1e-56 Identity = 104/108 (96.30%), Postives = 103/108 (95.37%), Query Frame = 1
BLAST of Cla001753 vs. Swiss-Prot
Match: RBL_FLAPR (Ribulose bisphosphate carboxylase large chain OS=Flaveria pringlei GN=rbcL PE=3 SV=1) HSP 1 Score: 217.2 bits (552), Expect = 9.1e-56 Identity = 104/108 (96.30%), Postives = 103/108 (95.37%), Query Frame = 1
BLAST of Cla001753 vs. TrEMBL
Match: A0A0C9S5Z3_9SPER (TSA: Wollemia nobilis Ref_Wollemi_Transcript_12312_3435 transcribed RNA sequence OS=Wollemia nobilis PE=3 SV=1) HSP 1 Score: 231.5 bits (589), Expect = 5.2e-58 Identity = 111/115 (96.52%), Postives = 111/115 (96.52%), Query Frame = 1
BLAST of Cla001753 vs. TrEMBL
Match: A0A0H3VXN4_9POAL (Ribulose bisphosphate carboxylase large chain OS=Otatea glauca GN=rbcL PE=3 SV=1) HSP 1 Score: 226.5 bits (576), Expect = 1.7e-56 Identity = 110/115 (95.65%), Postives = 110/115 (95.65%), Query Frame = 1
BLAST of Cla001753 vs. TrEMBL
Match: A0A0H3VYE9_9POAL (Ribulose bisphosphate carboxylase large chain OS=Pariana radiciflora GN=rbcL PE=3 SV=1) HSP 1 Score: 226.5 bits (576), Expect = 1.7e-56 Identity = 110/115 (95.65%), Postives = 110/115 (95.65%), Query Frame = 1
BLAST of Cla001753 vs. TrEMBL
Match: A0A0B2NQK2_GLYSO (Ribulose bisphosphate carboxylase large chain OS=Glycine soja GN=glysoja_042737 PE=3 SV=1) HSP 1 Score: 226.5 bits (576), Expect = 1.7e-56 Identity = 108/115 (93.91%), Postives = 110/115 (95.65%), Query Frame = 1
BLAST of Cla001753 vs. TrEMBL
Match: A0A0H3VVG5_9POAL (Ribulose bisphosphate carboxylase large chain OS=Chusquea sp. PFM-2015 GN=rbcL PE=3 SV=1) HSP 1 Score: 226.5 bits (576), Expect = 1.7e-56 Identity = 110/115 (95.65%), Postives = 110/115 (95.65%), Query Frame = 1
BLAST of Cla001753 vs. NCBI nr
Match: gi|74027109|gb|AAZ94659.1| (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Cucumis sativus]) HSP 1 Score: 229.9 bits (585), Expect = 2.2e-57 Identity = 111/115 (96.52%), Postives = 111/115 (96.52%), Query Frame = 1
BLAST of Cla001753 vs. NCBI nr
Match: gi|821158933|gb|AKH04857.1| (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (plastid) [Pariana sp. PFM-2015]) HSP 1 Score: 226.5 bits (576), Expect = 2.4e-56 Identity = 110/115 (95.65%), Postives = 110/115 (95.65%), Query Frame = 1
BLAST of Cla001753 vs. NCBI nr
Match: gi|734309146|gb|KHM99324.1| (Ribulose bisphosphate carboxylase large chain [Glycine soja]) HSP 1 Score: 226.5 bits (576), Expect = 2.4e-56 Identity = 108/115 (93.91%), Postives = 110/115 (95.65%), Query Frame = 1
BLAST of Cla001753 vs. NCBI nr
Match: gi|1015811109|gb|AMW66238.1| (ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit (plastid) [Licuala paludosa]) HSP 1 Score: 226.5 bits (576), Expect = 2.4e-56 Identity = 110/115 (95.65%), Postives = 110/115 (95.65%), Query Frame = 1
BLAST of Cla001753 vs. NCBI nr
Match: gi|374975206|gb|AFA27693.1| (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial (plastid) [Potarophytum riparium]) HSP 1 Score: 226.5 bits (576), Expect = 2.4e-56 Identity = 110/115 (95.65%), Postives = 110/115 (95.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|