Cla001091 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTCTTCAAGGTGCGGAGATATTGTTTTATCCTACAGCCATTGGTTCTGAACCTCAAGATGAAGGACTTGACTCTTGTGATCACTGGAAACGAGTAATGCAAGGGCATGCGGGTGCTAATGTGGTAAGTTTCTAGACAACGATATAGCTAATTATACATTATATTAGCTGAAGTATTAGTTTCTTTTTCAAGTTATTTGCTTTGTTTGAGGGCCTTGAATGAGTTATCTTTTTTAGGACCCTCCTTGGTCAACTAATGACAATCATTGAACAATTTGAATATTGATTTTTGTTTGTGTAGGTGAAATTTTTGCTTTTAAACGCACTGATTGGTGCTTTTGTTGAATACGATAACTAA ATGGTTCTTCAAGGTGCGGAGATATTGTTTTATCCTACAGCCATTGGTTCTGAACCTCAAGATGAAGGACTTGACTCTTGTGATCACTGGAAACGAGTAATGCAAGGGCATGCGGGTGCTAATGTGGTGAAATTTTTGCTTTTAAACGCACTGATTGGTGCTTTTGTTGAATACGATAACTAA ATGGTTCTTCAAGGTGCGGAGATATTGTTTTATCCTACAGCCATTGGTTCTGAACCTCAAGATGAAGGACTTGACTCTTGTGATCACTGGAAACGAGTAATGCAAGGGCATGCGGGTGCTAATGTGGTGAAATTTTTGCTTTTAAACGCACTGATTGGTGCTTTTGTTGAATACGATAACTAA MVLQGAEILFYPTAIGSEPQDEGLDSCDHWKRVMQGHAGANVVKFLLLNALIGAFVEYDN
BLAST of Cla001091 vs. Swiss-Prot
Match: NILP1_ARATH (N-carbamoylputrescine amidase OS=Arabidopsis thaliana GN=CPA PE=1 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.5e-17 Identity = 42/60 (70.00%), Postives = 47/60 (78.33%), Query Frame = 1
BLAST of Cla001091 vs. Swiss-Prot
Match: AGUB_SOLLC (N-carbamoylputrescine amidase OS=Solanum lycopersicum GN=CPA PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 5.7e-17 Identity = 40/60 (66.67%), Postives = 46/60 (76.67%), Query Frame = 1
BLAST of Cla001091 vs. Swiss-Prot
Match: AGUB_SOLTU (N-carbamoylputrescine amidase OS=Solanum tuberosum GN=CPA PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 5.7e-17 Identity = 40/60 (66.67%), Postives = 46/60 (76.67%), Query Frame = 1
BLAST of Cla001091 vs. Swiss-Prot
Match: AGUB_ORYSJ (N-carbamoylputrescine amidase OS=Oryza sativa subsp. japonica GN=CPA PE=2 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 4.8e-16 Identity = 41/60 (68.33%), Postives = 45/60 (75.00%), Query Frame = 1
BLAST of Cla001091 vs. TrEMBL
Match: W1PSJ6_AMBTC (Uncharacterized protein OS=Amborella trichopoda GN=AMTR_s00040p00090100 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.3e-17 Identity = 45/60 (75.00%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of Cla001091 vs. TrEMBL
Match: A0A061GZP8_THECC (Nitrilase-like protein 1 isoform 1 OS=Theobroma cacao GN=TCM_041385 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 4.0e-17 Identity = 44/60 (73.33%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of Cla001091 vs. TrEMBL
Match: A0A061GU72_THECC (Nitrilase-like protein 1 isoform 2 OS=Theobroma cacao GN=TCM_041385 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 4.0e-17 Identity = 44/60 (73.33%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of Cla001091 vs. TrEMBL
Match: A0A0A0LT48_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G166770 PE=4 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.2e-16 Identity = 43/60 (71.67%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of Cla001091 vs. TrEMBL
Match: E7AIL9_PLAMJ (N-carbamoylputrescine amidohydrolase (Fragment) OS=Plantago major GN=cpa1 PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 7.5e-16 Identity = 43/60 (71.67%), Postives = 49/60 (81.67%), Query Frame = 1
BLAST of Cla001091 vs. TAIR10
Match: AT2G27450.2 (AT2G27450.2 nitrilase-like protein 1) HSP 1 Score: 89.4 bits (220), Expect = 8.4e-19 Identity = 42/60 (70.00%), Postives = 47/60 (78.33%), Query Frame = 1
BLAST of Cla001091 vs. NCBI nr
Match: gi|586749738|ref|XP_006851426.1| (PREDICTED: N-carbamoylputrescine amidase [Amborella trichopoda]) HSP 1 Score: 95.5 bits (236), Expect = 3.3e-17 Identity = 45/60 (75.00%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of Cla001091 vs. NCBI nr
Match: gi|659071642|ref|XP_008461184.1| (PREDICTED: N-carbamoylputrescine amidase [Cucumis melo]) HSP 1 Score: 95.1 bits (235), Expect = 4.4e-17 Identity = 43/45 (95.56%), Postives = 44/45 (97.78%), Query Frame = 1
BLAST of Cla001091 vs. NCBI nr
Match: gi|590586755|ref|XP_007015791.1| (Nitrilase-like protein 1 isoform 2 [Theobroma cacao]) HSP 1 Score: 94.7 bits (234), Expect = 5.7e-17 Identity = 44/60 (73.33%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of Cla001091 vs. NCBI nr
Match: gi|590586752|ref|XP_007015790.1| (Nitrilase-like protein 1 isoform 1 [Theobroma cacao]) HSP 1 Score: 94.7 bits (234), Expect = 5.7e-17 Identity = 44/60 (73.33%), Postives = 50/60 (83.33%), Query Frame = 1
BLAST of Cla001091 vs. NCBI nr
Match: gi|1009113287|ref|XP_015872695.1| (PREDICTED: N-carbamoylputrescine amidase [Ziziphus jujuba]) HSP 1 Score: 94.4 bits (233), Expect = 7.4e-17 Identity = 43/60 (71.67%), Postives = 50/60 (83.33%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|