ClCG11G008780 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGATAACAACAAGAATGGTGTGTCTGCTCAAACTGAGCCTGATCTCCTCACTCCTTACAAGATGGGGAAGTTTAATCTTTCTCACAGGTACTGTACTCTACTTCCATCCATCCACTTTACAACCTAAACTTTAAACTATCATCTAATTTAATCATTACTCACCATCTTCATCTTCATCTTCAACCAACAATTTTTCTTCAGAATCGTATTGGCTCCATTGACAAGGCAAAGGTCCTACAACAACCTTCCTCAGCAACATGCAATCTTATATTACTCCCAGAGGACAACCAAAGGGGGTTTCTTAATTGCTGAGGCCACCGGAGTTTCTGACACTGCCCAAGGGTAA ATGGCTGATAACAACAAGAATGGTGTGTCTGCTCAAACTGAGCCTGATCTCCTCACTCCTTACAAGATGGGGAAGTTTAATCTTTCTCACAGAATCGTATTGGCTCCATTGACAAGGCAAAGGTCCTACAACAACCTTCCTCAGCAACATGCAATCTTATATTACTCCCAGAGGACAACCAAAGGGGGTTTCTTAATTGCTGAGGCCACCGGAGTTTCTGACACTGCCCAAGGGTAA ATGGCTGATAACAACAAGAATGGTGTGTCTGCTCAAACTGAGCCTGATCTCCTCACTCCTTACAAGATGGGGAAGTTTAATCTTTCTCACAGAATCGTATTGGCTCCATTGACAAGGCAAAGGTCCTACAACAACCTTCCTCAGCAACATGCAATCTTATATTACTCCCAGAGGACAACCAAAGGGGGTTTCTTAATTGCTGAGGCCACCGGAGTTTCTGACACTGCCCAAGGGTAA MADNNKNGVSAQTEPDLLTPYKMGKFNLSHRIVLAPLTRQRSYNNLPQQHAILYYSQRTTKGGFLIAEATGVSDTAQG
BLAST of ClCG11G008780 vs. Swiss-Prot
Match: OPR1_ARATH (12-oxophytodienoate reductase 1 OS=Arabidopsis thaliana GN=OPR1 PE=1 SV=2) HSP 1 Score: 117.5 bits (293), Expect = 6.7e-26 Identity = 57/73 (78.08%), Postives = 62/73 (84.93%), Query Frame = 1
BLAST of ClCG11G008780 vs. Swiss-Prot
Match: OPR2_ARATH (12-oxophytodienoate reductase 2 OS=Arabidopsis thaliana GN=OPR2 PE=1 SV=2) HSP 1 Score: 114.4 bits (285), Expect = 5.6e-25 Identity = 56/72 (77.78%), Postives = 62/72 (86.11%), Query Frame = 1
BLAST of ClCG11G008780 vs. Swiss-Prot
Match: OPR11_ORYSJ (Putative 12-oxophytodienoate reductase 11 OS=Oryza sativa subsp. japonica GN=OPR11 PE=2 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 7.4e-25 Identity = 53/62 (85.48%), Postives = 56/62 (90.32%), Query Frame = 1
BLAST of ClCG11G008780 vs. Swiss-Prot
Match: OPR4_ORYSJ (Putative 12-oxophytodienoate reductase 4 OS=Oryza sativa subsp. japonica GN=OPR4 PE=2 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 3.1e-23 Identity = 51/78 (65.38%), Postives = 58/78 (74.36%), Query Frame = 1
BLAST of ClCG11G008780 vs. Swiss-Prot
Match: OPR12_ORYSJ (Putative 12-oxophytodienoate reductase 12 OS=Oryza sativa subsp. japonica GN=OPR12 PE=2 SV=2) HSP 1 Score: 104.8 bits (260), Expect = 4.5e-22 Identity = 53/75 (70.67%), Postives = 59/75 (78.67%), Query Frame = 1
BLAST of ClCG11G008780 vs. TrEMBL
Match: A0A0A0LMD3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G395815 PE=4 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 1.1e-30 Identity = 72/80 (90.00%), Postives = 74/80 (92.50%), Query Frame = 1
BLAST of ClCG11G008780 vs. TrEMBL
Match: A0A0A0K7E1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G063995 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 9.4e-27 Identity = 61/66 (92.42%), Postives = 62/66 (93.94%), Query Frame = 1
BLAST of ClCG11G008780 vs. TrEMBL
Match: A5AVR2_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_033920 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 1.8e-25 Identity = 59/72 (81.94%), Postives = 66/72 (91.67%), Query Frame = 1
BLAST of ClCG11G008780 vs. TrEMBL
Match: F6I449_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_18s0041g02060 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 3.9e-25 Identity = 58/72 (80.56%), Postives = 66/72 (91.67%), Query Frame = 1
BLAST of ClCG11G008780 vs. TrEMBL
Match: A5BY60_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_031221 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 3.9e-25 Identity = 58/72 (80.56%), Postives = 66/72 (91.67%), Query Frame = 1
BLAST of ClCG11G008780 vs. TAIR10
Match: AT1G76680.2 (AT1G76680.2 12-oxophytodienoate reductase 1) HSP 1 Score: 117.5 bits (293), Expect = 3.8e-27 Identity = 57/73 (78.08%), Postives = 62/73 (84.93%), Query Frame = 1
BLAST of ClCG11G008780 vs. TAIR10
Match: AT1G76690.1 (AT1G76690.1 12-oxophytodienoate reductase 2) HSP 1 Score: 114.4 bits (285), Expect = 3.2e-26 Identity = 56/72 (77.78%), Postives = 62/72 (86.11%), Query Frame = 1
BLAST of ClCG11G008780 vs. TAIR10
Match: AT1G17990.1 (AT1G17990.1 FMN-linked oxidoreductases superfamily protein) HSP 1 Score: 90.5 bits (223), Expect = 4.9e-19 Identity = 43/62 (69.35%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of ClCG11G008780 vs. TAIR10
Match: AT1G18020.1 (AT1G18020.1 FMN-linked oxidoreductases superfamily protein) HSP 1 Score: 90.5 bits (223), Expect = 4.9e-19 Identity = 43/62 (69.35%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of ClCG11G008780 vs. TAIR10
Match: AT1G09400.1 (AT1G09400.1 FMN-linked oxidoreductases superfamily protein) HSP 1 Score: 81.3 bits (199), Expect = 3.0e-16 Identity = 37/54 (68.52%), Postives = 41/54 (75.93%), Query Frame = 1
BLAST of ClCG11G008780 vs. NCBI nr
Match: gi|659081096|ref|XP_008441149.1| (PREDICTED: putative 12-oxophytodienoate reductase 11 [Cucumis melo]) HSP 1 Score: 141.4 bits (355), Expect = 6.9e-31 Identity = 73/80 (91.25%), Postives = 74/80 (92.50%), Query Frame = 1
BLAST of ClCG11G008780 vs. NCBI nr
Match: gi|778672814|ref|XP_004138673.2| (PREDICTED: 12-oxophytodienoate reductase 1 [Cucumis sativus]) HSP 1 Score: 140.2 bits (352), Expect = 1.5e-30 Identity = 72/80 (90.00%), Postives = 74/80 (92.50%), Query Frame = 1
BLAST of ClCG11G008780 vs. NCBI nr
Match: gi|659110344|ref|XP_008455178.1| (PREDICTED: putative 12-oxophytodienoate reductase 11 [Cucumis melo]) HSP 1 Score: 127.5 bits (319), Expect = 1.0e-26 Identity = 61/66 (92.42%), Postives = 63/66 (95.45%), Query Frame = 1
BLAST of ClCG11G008780 vs. NCBI nr
Match: gi|778724435|ref|XP_011658804.1| (PREDICTED: putative 12-oxophytodienoate reductase 11 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 1.3e-26 Identity = 61/66 (92.42%), Postives = 62/66 (93.94%), Query Frame = 1
BLAST of ClCG11G008780 vs. NCBI nr
Match: gi|700188503|gb|KGN43736.1| (hypothetical protein Csa_7G063995 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 1.3e-26 Identity = 61/66 (92.42%), Postives = 62/66 (93.94%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|