ClCG10G013820 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAGTAAAAGAAATAGTTATCTGGAGTCTGATCATGGCAGGTTATGGAATCCCGGGACAAGGAAGAGAAGATTTGAAACTGTTTGACAAAATGATAGAGACATCAGAAGTTATGCCCAACGAAGTAACATTTCTCTCATTGTTACTGCTTGTAGCCACGCCAGTTTAATTTAAGAAGGGATGAAGATATTCAACATGATGTTGCATGAATACAGAATAAAACCCAACACAGAGCATTATGTCATCAATGTCAATCTTCTTGGTCGAACAGGAGAACTCAACAGGGCAAAGTGTGATTGAAGCAGGAACTGAGGTCCATAGTTCCGTAACTGATGACAGATTACACCCAGAATCTGACCACATTCATAGGTTACAAGGAAATTTGAGAGATGAAGGTTATTTCAAAATCTTATTTACAGAACATTGA ATGAAAGTAAAAGAAATAGTTATCTGGAGTCTGATCATGGCAGGTTATGGAATCCCGGGACAAGGAAGAGAAGATTTGAAACTGTTTGACAAAATGATAGAGACATCAGAAGTTATGCCCAACGAAGAGAACTCAACAGGGCAAAGTGTGATTGAAGCAGGAACTGAGGTCCATAGTTCCGTAACTGATGACAGATTACACCCAGAATCTGACCACATTCATAGGTTACAAGGAAATTTGAGAGATGAAGGTTATTTCAAAATCTTATTTACAGAACATTGA ATGAAAGTAAAAGAAATAGTTATCTGGAGTCTGATCATGGCAGGTTATGGAATCCCGGGACAAGGAAGAGAAGATTTGAAACTGTTTGACAAAATGATAGAGACATCAGAAGTTATGCCCAACGAAGAGAACTCAACAGGGCAAAGTGTGATTGAAGCAGGAACTGAGGTCCATAGTTCCGTAACTGATGACAGATTACACCCAGAATCTGACCACATTCATAGGTTACAAGGAAATTTGAGAGATGAAGGTTATTTCAAAATCTTATTTACAGAACATTGA MKVKEIVIWSLIMAGYGIPGQGREDLKLFDKMIETSEVMPNEENSTGQSVIEAGTEVHSSVTDDRLHPESDHIHRLQGNLRDEGYFKILFTEH
BLAST of ClCG10G013820 vs. TrEMBL
Match: A0A0A0LFK2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G840360 PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.3e-10 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 1
BLAST of ClCG10G013820 vs. TrEMBL
Match: A0A0A0LFK2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G840360 PE=4 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 2.3e-03 Identity = 24/34 (70.59%), Postives = 27/34 (79.41%), Query Frame = 1
HSP 2 Score: 30.4 bits (67), Expect = 1.4e+03 Identity = 13/34 (38.24%), Postives = 21/34 (61.76%), Query Frame = 1
HSP 3 Score: 60.1 bits (144), Expect = 1.7e-06 Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = 1
BLAST of ClCG10G013820 vs. TrEMBL
Match: A0A118K5K9_CYNCS (Pentatricopeptide repeat-containing protein OS=Cynara cardunculus var. scolymus GN=Ccrd_012361 PE=4 SV=1) HSP 1 Score: 38.5 bits (88), Expect = 5.2e+00 Identity = 19/45 (42.22%), Postives = 30/45 (66.67%), Query Frame = 1
HSP 2 Score: 58.2 bits (139), Expect = 6.4e-06 Identity = 33/79 (41.77%), Postives = 49/79 (62.03%), Query Frame = 1
BLAST of ClCG10G013820 vs. TrEMBL
Match: A0A061EEG8_THECC (Tetratricopeptide repeat (TPR)-like superfamily protein, putative OS=Theobroma cacao GN=TCM_018394 PE=4 SV=1) HSP 1 Score: 39.7 bits (91), Expect = 2.3e+00 Identity = 17/33 (51.52%), Postives = 22/33 (66.67%), Query Frame = 1
HSP 2 Score: 57.8 bits (138), Expect = 8.3e-06 Identity = 31/77 (40.26%), Postives = 45/77 (58.44%), Query Frame = 1
BLAST of ClCG10G013820 vs. TrEMBL
Match: A0A059AH32_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_J02252 PE=4 SV=1) HSP 1 Score: 34.7 bits (78), Expect = 7.6e+01 Identity = 19/43 (44.19%), Postives = 24/43 (55.81%), Query Frame = 1
HSP 2 Score: 32.3 bits (72), Expect = 3.7e+02 Identity = 22/72 (30.56%), Postives = 32/72 (44.44%), Query Frame = 1
BLAST of ClCG10G013820 vs. TAIR10
Match: AT3G01580.1 (AT3G01580.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 48.1 bits (113), Expect = 3.3e-06 Identity = 26/78 (33.33%), Postives = 41/78 (52.56%), Query Frame = 1
HSP 2 Score: 32.3 bits (72), Expect = 1.9e-01 Identity = 19/61 (31.15%), Postives = 26/61 (42.62%), Query Frame = 1
BLAST of ClCG10G013820 vs. NCBI nr
Match: gi|700204576|gb|KGN59709.1| (hypothetical protein Csa_3G840360 [Cucumis sativus]) HSP 1 Score: 72.0 bits (175), Expect = 6.1e-10 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 1
BLAST of ClCG10G013820 vs. NCBI nr
Match: gi|700204576|gb|KGN59709.1| (hypothetical protein Csa_3G840360 [Cucumis sativus]) HSP 1 Score: 49.7 bits (117), Expect = 3.3e-03 Identity = 24/34 (70.59%), Postives = 27/34 (79.41%), Query Frame = 1
HSP 2 Score: 30.4 bits (67), Expect = 2.0e+03 Identity = 13/34 (38.24%), Postives = 21/34 (61.76%), Query Frame = 1
HSP 3 Score: 72.0 bits (175), Expect = 6.1e-10 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 1
BLAST of ClCG10G013820 vs. NCBI nr
Match: gi|778685923|ref|XP_011652303.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580 [Cucumis sativus]) HSP 1 Score: 49.7 bits (117), Expect = 3.3e-03 Identity = 24/34 (70.59%), Postives = 27/34 (79.41%), Query Frame = 1
HSP 2 Score: 30.4 bits (67), Expect = 2.0e+03 Identity = 13/34 (38.24%), Postives = 21/34 (61.76%), Query Frame = 1
HSP 3 Score: 72.0 bits (175), Expect = 6.1e-10 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 1
BLAST of ClCG10G013820 vs. NCBI nr
Match: gi|659129955|ref|XP_008464928.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580 [Cucumis melo]) HSP 1 Score: 50.8 bits (120), Expect = 1.5e-03 Identity = 27/43 (62.79%), Postives = 30/43 (69.77%), Query Frame = 1
HSP 2 Score: 30.8 bits (68), Expect = 1.6e+03 Identity = 20/69 (28.99%), Postives = 33/69 (47.83%), Query Frame = 1
HSP 3 Score: 60.1 bits (144), Expect = 2.4e-06 Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = 1
BLAST of ClCG10G013820 vs. NCBI nr
Match: gi|976925348|gb|KVI09257.1| (Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus]) HSP 1 Score: 38.5 bits (88), Expect = 7.5e+00 Identity = 19/45 (42.22%), Postives = 30/45 (66.67%), Query Frame = 1
HSP 2 Score: 60.1 bits (144), Expect = 2.4e-06 Identity = 29/77 (37.66%), Postives = 50/77 (64.94%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |