ClCG10G013810 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACATCCAAGTCAATGGGAACCTTCAATACCATGATGTTGAACAACATAAATCCTGATGTTGCCATTGTGAAAATTCTTACCTCTTGTTCAGCTTTGGGCATTCTCCAACAAGCACTTTGCCTCCATGACTATTTTGTTAAAACTGGCTTCACTGTAATGTTTCTGTAGGAGCTTCGATCATAGAGCTGTGTTCGAAATGCGACAGCATAATTAA ATGACATCCAAGTCAATGGGAACCTTCAATACCATGATGTTGAACAACATAAATCCTGATGTTGCCATTGTGAAAATTCTTACCTCTTGTTCAGCTTTGGGCATTCTCCAACAAGCACTTTGCCTCCATGACTATTTTGTTAAAACTGGCTTCACTGTAATGAGCTTCGATCATAGAGCTGTGTTCGAAATGCGACAGCATAATTAA ATGACATCCAAGTCAATGGGAACCTTCAATACCATGATGTTGAACAACATAAATCCTGATGTTGCCATTGTGAAAATTCTTACCTCTTGTTCAGCTTTGGGCATTCTCCAACAAGCACTTTGCCTCCATGACTATTTTGTTAAAACTGGCTTCACTGTAATGAGCTTCGATCATAGAGCTGTGTTCGAAATGCGACAGCATAATTAA MTSKSMGTFNTMMLNNINPDVAIVKILTSCSALGILQQALCLHDYFVKTGFTVMSFDHRAVFEMRQHN
BLAST of ClCG10G013810 vs. Swiss-Prot
Match: PP205_ARATH (Putative pentatricopeptide repeat-containing protein At3g01580 OS=Arabidopsis thaliana GN=PCMP-E87 PE=3 SV=2) HSP 1 Score: 52.4 bits (124), Expect = 2.3e-06 Identity = 28/66 (42.42%), Postives = 38/66 (57.58%), Query Frame = 1
BLAST of ClCG10G013810 vs. TrEMBL
Match: A0A0A0LFK2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G840360 PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.2e-14 Identity = 45/65 (69.23%), Postives = 51/65 (78.46%), Query Frame = 1
BLAST of ClCG10G013810 vs. TrEMBL
Match: M5WYF2_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica GN=PRUPE_ppa015626mg PE=4 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-07 Identity = 33/65 (50.77%), Postives = 42/65 (64.62%), Query Frame = 1
BLAST of ClCG10G013810 vs. TrEMBL
Match: F6HUU4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_14s0066g00420 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.9e-07 Identity = 33/65 (50.77%), Postives = 42/65 (64.62%), Query Frame = 1
BLAST of ClCG10G013810 vs. TrEMBL
Match: A0A118K5K9_CYNCS (Pentatricopeptide repeat-containing protein OS=Cynara cardunculus var. scolymus GN=Ccrd_012361 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.9e-07 Identity = 33/64 (51.56%), Postives = 41/64 (64.06%), Query Frame = 1
BLAST of ClCG10G013810 vs. TrEMBL
Match: A0A059AH32_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_J02252 PE=4 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 4.2e-07 Identity = 30/53 (56.60%), Postives = 39/53 (73.58%), Query Frame = 1
BLAST of ClCG10G013810 vs. TAIR10
Match: AT3G01580.1 (AT3G01580.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 52.4 bits (124), Expect = 1.3e-07 Identity = 28/66 (42.42%), Postives = 38/66 (57.58%), Query Frame = 1
BLAST of ClCG10G013810 vs. NCBI nr
Match: gi|778685923|ref|XP_011652303.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580 [Cucumis sativus]) HSP 1 Score: 86.7 bits (213), Expect = 1.8e-14 Identity = 45/65 (69.23%), Postives = 51/65 (78.46%), Query Frame = 1
BLAST of ClCG10G013810 vs. NCBI nr
Match: gi|700204576|gb|KGN59709.1| (hypothetical protein Csa_3G840360 [Cucumis sativus]) HSP 1 Score: 86.7 bits (213), Expect = 1.8e-14 Identity = 45/65 (69.23%), Postives = 51/65 (78.46%), Query Frame = 1
BLAST of ClCG10G013810 vs. NCBI nr
Match: gi|659129955|ref|XP_008464928.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580 [Cucumis melo]) HSP 1 Score: 86.7 bits (213), Expect = 1.8e-14 Identity = 45/65 (69.23%), Postives = 51/65 (78.46%), Query Frame = 1
BLAST of ClCG10G013810 vs. NCBI nr
Match: gi|645248952|ref|XP_008230528.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580 [Prunus mume]) HSP 1 Score: 63.9 bits (154), Expect = 1.2e-07 Identity = 33/65 (50.77%), Postives = 42/65 (64.62%), Query Frame = 1
BLAST of ClCG10G013810 vs. NCBI nr
Match: gi|595972200|ref|XP_007217623.1| (hypothetical protein PRUPE_ppa015626mg, partial [Prunus persica]) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-07 Identity = 33/65 (50.77%), Postives = 42/65 (64.62%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |