ClCG09G014990 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAATGCCAAAGAATGCAAAAAGAAGAGGTGGAGAAGCAATACTTTCAGATGCCTACACCATCAATGGCCAACCAGGATATCTCTATCCATGTTCCAAACAAGGGACAAAATCTTTAATTCAAATTTCCTATCCATGCAATTCTTCAATTTTTTTAAAGTAATAATAATCTTACTTCATTTGCTTATGATTTTCAAATTTCATTGTTGAGTGTATATATTTGCTCTTACATGTTTTTTTTTTTCTTTTTTTTTTTTTAGCTCTTTCTCATTCTTTGATTTCTTTTTGATATTTGACATTTATTTTTCATAA ATGGAAATGCCAAAGAATGCAAAAAGAAGAGGTGGAGAAGCAATACTTTCAGATGCCTACACCATCAATGGCCAACCAGGATATCTCTATCCATGTTCCAAACAAGGGACAAAATCTTTAATTCAAATTTCCTATCCATGCAATTCTTCAATTTTTTTAAACTCTTTCTCATTCTTTGATTTCTTTTTGATATTTGACATTTATTTTTCATAA ATGGAAATGCCAAAGAATGCAAAAAGAAGAGGTGGAGAAGCAATACTTTCAGATGCCTACACCATCAATGGCCAACCAGGATATCTCTATCCATGTTCCAAACAAGGGACAAAATCTTTAATTCAAATTTCCTATCCATGCAATTCTTCAATTTTTTTAAACTCTTTCTCATTCTTTGATTTCTTTTTGATATTTGACATTTATTTTTCATAA MEMPKNAKRRGGEAILSDAYTINGQPGYLYPCSKQGTKSLIQISYPCNSSIFLNSFSFFDFFLIFDIYFS
BLAST of ClCG09G014990 vs. Swiss-Prot
Match: LAC14_ARATH (Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.3e-07 Identity = 24/37 (64.86%), Postives = 26/37 (70.27%), Query Frame = 1
BLAST of ClCG09G014990 vs. TrEMBL
Match: V4L0B3_EUTSA (Uncharacterized protein OS=Eutrema salsugineum GN=EUTSA_v10002968mg PE=4 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-07 Identity = 31/55 (56.36%), Postives = 38/55 (69.09%), Query Frame = 1
BLAST of ClCG09G014990 vs. TrEMBL
Match: V4LB16_EUTSA (Laccase OS=Eutrema salsugineum GN=EUTSA_v10015612mg PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.9e-07 Identity = 26/37 (70.27%), Postives = 32/37 (86.49%), Query Frame = 1
BLAST of ClCG09G014990 vs. TrEMBL
Match: M5Y906_PRUPE (Laccase OS=Prunus persica GN=PRUPE_ppa016865mg PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.5e-07 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 1
BLAST of ClCG09G014990 vs. TrEMBL
Match: G7ILB5_MEDTR (Laccase OS=Medicago truncatula GN=MTR_2g008330 PE=3 SV=2) HSP 1 Score: 62.4 bits (150), Expect = 2.5e-07 Identity = 28/41 (68.29%), Postives = 33/41 (80.49%), Query Frame = 1
BLAST of ClCG09G014990 vs. TrEMBL
Match: A0A022PRX8_ERYGU (Laccase OS=Erythranthe guttata GN=MIMGU_mgv1a019066mg PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 5.7e-07 Identity = 28/37 (75.68%), Postives = 31/37 (83.78%), Query Frame = 1
BLAST of ClCG09G014990 vs. TAIR10
Match: AT5G09360.1 (AT5G09360.1 laccase 14) HSP 1 Score: 56.6 bits (135), Expect = 7.1e-09 Identity = 24/37 (64.86%), Postives = 26/37 (70.27%), Query Frame = 1
BLAST of ClCG09G014990 vs. TAIR10
Match: AT2G30210.1 (AT2G30210.1 laccase 3) HSP 1 Score: 46.6 bits (109), Expect = 7.3e-06 Identity = 22/37 (59.46%), Postives = 25/37 (67.57%), Query Frame = 1
BLAST of ClCG09G014990 vs. NCBI nr
Match: gi|659111019|ref|XP_008455534.1| (PREDICTED: laccase-14 [Cucumis melo]) HSP 1 Score: 68.9 bits (167), Expect = 3.9e-09 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of ClCG09G014990 vs. NCBI nr
Match: gi|449438540|ref|XP_004137046.1| (PREDICTED: laccase-14 [Cucumis sativus]) HSP 1 Score: 68.2 bits (165), Expect = 6.7e-09 Identity = 30/37 (81.08%), Postives = 33/37 (89.19%), Query Frame = 1
BLAST of ClCG09G014990 vs. NCBI nr
Match: gi|1009151145|ref|XP_015893395.1| (PREDICTED: LOW QUALITY PROTEIN: laccase-14-like [Ziziphus jujuba]) HSP 1 Score: 67.8 bits (164), Expect = 8.7e-09 Identity = 29/37 (78.38%), Postives = 33/37 (89.19%), Query Frame = 1
BLAST of ClCG09G014990 vs. NCBI nr
Match: gi|658008133|ref|XP_008339252.1| (PREDICTED: laccase-14 [Malus domestica]) HSP 1 Score: 64.3 bits (155), Expect = 9.6e-08 Identity = 29/37 (78.38%), Postives = 31/37 (83.78%), Query Frame = 1
BLAST of ClCG09G014990 vs. NCBI nr
Match: gi|567157939|ref|XP_006418593.1| (hypothetical protein EUTSA_v10002968mg [Eutrema salsugineum]) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-07 Identity = 31/55 (56.36%), Postives = 38/55 (69.09%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|