ClCG05G004560 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGGATTGCAAAGGTACGAAACGACTTGTTGTCTGTTTAACATAAATGTTTTTAGTCATTATTTATGTGGGTTTTCTATAGGGTGTTTTAATTTGTATAATATTTTGAAGAAGGTATGATAACTTAAATATTTTTTTCCTAACTCAAATTATTAATTATGTTAACATAAAAATTTGTTGATAATTGGTATATTAATGCAGGCAAGAGCTCTTGGCCCGAGTTGGTTGGAGTTTTGGGAGACGTAGCTCAAAAGATTATTGAGAAAGAGAATCATTATGTTCATGCAAGAGTTGTTGAAGAAGGAACATTTGTTACACAAGATTTCAGGTGTGATAGGGTTTGGGTTTGGGTTGATAAGTACACCCACATTGTTATAATTACTCCTGTAATTGGTTGA ATGTCGGATTGCAAAGGCAAGAGCTCTTGGCCCGAGTTGGTTGGAGTTTTGGGAGACGTAGCTCAAAAGATTATTGAGAAAGAGAATCATTATGTTCATGCAAGAGTTGTTGAAGAAGGAACATTTGTTACACAAGATTTCAGGTGTGATAGGGTTTGGGTTTGGGTTGATAAGTACACCCACATTGTTATAATTACTCCTGTAATTGGTTGA ATGTCGGATTGCAAAGGCAAGAGCTCTTGGCCCGAGTTGGTTGGAGTTTTGGGAGACGTAGCTCAAAAGATTATTGAGAAAGAGAATCATTATGTTCATGCAAGAGTTGTTGAAGAAGGAACATTTGTTACACAAGATTTCAGGTGTGATAGGGTTTGGGTTTGGGTTGATAAGTACACCCACATTGTTATAATTACTCCTGTAATTGGTTGA MSDCKGKSSWPELVGVLGDVAQKIIEKENHYVHARVVEEGTFVTQDFRCDRVWVWVDKYTHIVIITPVIG
BLAST of ClCG05G004560 vs. Swiss-Prot
Match: ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.4e-14 Identity = 40/69 (57.97%), Postives = 49/69 (71.01%), Query Frame = 1
BLAST of ClCG05G004560 vs. Swiss-Prot
Match: ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.7e-12 Identity = 31/56 (55.36%), Postives = 42/56 (75.00%), Query Frame = 1
BLAST of ClCG05G004560 vs. Swiss-Prot
Match: BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 8.4e-12 Identity = 37/69 (53.62%), Postives = 43/69 (62.32%), Query Frame = 1
BLAST of ClCG05G004560 vs. Swiss-Prot
Match: ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus PE=1 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 7.1e-11 Identity = 35/65 (53.85%), Postives = 40/65 (61.54%), Query Frame = 1
BLAST of ClCG05G004560 vs. Swiss-Prot
Match: HPI_HEVBR (Protease inhibitor HPI OS=Hevea brasiliensis GN=PI1 PE=1 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 1.3e-09 Identity = 35/69 (50.72%), Postives = 42/69 (60.87%), Query Frame = 1
BLAST of ClCG05G004560 vs. TrEMBL
Match: A0A0A0L4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142970 PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.2e-25 Identity = 55/68 (80.88%), Postives = 63/68 (92.65%), Query Frame = 1
BLAST of ClCG05G004560 vs. TrEMBL
Match: A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.1e-18 Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
BLAST of ClCG05G004560 vs. TrEMBL
Match: B9S4U9_RICCO (Proteinase inhibitor, putative OS=Ricinus communis GN=RCOM_0992990 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.9e-16 Identity = 45/70 (64.29%), Postives = 52/70 (74.29%), Query Frame = 1
BLAST of ClCG05G004560 vs. TrEMBL
Match: A0A0L9TY84_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan02g169300 PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.5e-15 Identity = 46/70 (65.71%), Postives = 51/70 (72.86%), Query Frame = 1
BLAST of ClCG05G004560 vs. TrEMBL
Match: A0A0S3SPN1_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.08G139300 PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.5e-15 Identity = 46/70 (65.71%), Postives = 51/70 (72.86%), Query Frame = 1
BLAST of ClCG05G004560 vs. TAIR10
Match: AT2G38870.1 (AT2G38870.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 69.3 bits (168), Expect = 1.1e-12 Identity = 36/69 (52.17%), Postives = 45/69 (65.22%), Query Frame = 1
BLAST of ClCG05G004560 vs. TAIR10
Match: AT5G43580.1 (AT5G43580.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 64.3 bits (155), Expect = 3.4e-11 Identity = 31/65 (47.69%), Postives = 44/65 (67.69%), Query Frame = 1
BLAST of ClCG05G004560 vs. TAIR10
Match: AT2G38900.2 (AT2G38900.2 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 63.9 bits (154), Expect = 4.4e-11 Identity = 31/65 (47.69%), Postives = 40/65 (61.54%), Query Frame = 1
BLAST of ClCG05G004560 vs. TAIR10
Match: AT5G43570.1 (AT5G43570.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 50.8 bits (120), Expect = 3.9e-07 Identity = 28/62 (45.16%), Postives = 37/62 (59.68%), Query Frame = 1
BLAST of ClCG05G004560 vs. NCBI nr
Match: gi|700201772|gb|KGN56905.1| (hypothetical protein Csa_3G142970 [Cucumis sativus]) HSP 1 Score: 123.2 bits (308), Expect = 1.7e-25 Identity = 55/68 (80.88%), Postives = 63/68 (92.65%), Query Frame = 1
BLAST of ClCG05G004560 vs. NCBI nr
Match: gi|449432606|ref|XP_004134090.1| (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus]) HSP 1 Score: 100.1 bits (248), Expect = 1.6e-18 Identity = 48/67 (71.64%), Postives = 52/67 (77.61%), Query Frame = 1
BLAST of ClCG05G004560 vs. NCBI nr
Match: gi|659076233|ref|XP_008438570.1| (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis melo]) HSP 1 Score: 94.4 bits (233), Expect = 8.7e-17 Identity = 45/67 (67.16%), Postives = 50/67 (74.63%), Query Frame = 1
BLAST of ClCG05G004560 vs. NCBI nr
Match: gi|255559975|ref|XP_002521006.1| (PREDICTED: proteinase inhibitor [Ricinus communis]) HSP 1 Score: 91.7 bits (226), Expect = 5.6e-16 Identity = 45/70 (64.29%), Postives = 52/70 (74.29%), Query Frame = 1
BLAST of ClCG05G004560 vs. NCBI nr
Match: gi|920692318|gb|KOM35543.1| (hypothetical protein LR48_Vigan02g169300 [Vigna angularis]) HSP 1 Score: 89.0 bits (219), Expect = 3.6e-15 Identity = 46/70 (65.71%), Postives = 51/70 (72.86%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |