ClCG04G011060 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGAAAGTTCAATTCCATACCAACTTCTCATTGCCTCTCTGATTCTGGCGTCAACTTGACCGGTCGGAACTTCCATCCCCGTCAGAACGAGCTCATCGGCGCAATCACCCAAGCTCTGCCTGGCGGCGTTGTTTGAATGCTTTCGATGGGGCTTTTGTCTTCTCTCTGCGTCTGCTTGCAGAAAAGACTTAAAGCAGCTAATTCTGCGAGTGACGATGAAGCGGATGATGAAGATGTATCCACTGACATCTTCTTTGAACTAAGTTCTTTGCAAATTGCAACTAATTTCTTTTCCGAGGCGAATAAACTCGGCAATGGAGGGTTTGGGCCCGTCTACAAGGTACGATTCGTTTGTTCTGACCTAATGGATTGTTAGGCATTGTTCTTGGAAGTTGAAATGTTGAATATCTTCGTTCTGTTTTCTCATTTTCGACTCTGA ATGAGAAAGTTCAATTCCATACCAACTTCTCATTGCCTCTCTGATTCTGGCGTCAACTTGACCGGTCGGAACTTCCATCCCCGTCAGAACGAGCTCATCGGCGCAATCACCCAAGCTCTGCCTGGCGGCGTTAAAAGACTTAAAGCAGCTAATTCTGCGAGTGACGATGAAGCGGATGATGAAGATGTATCCACTGACATCTTCTTTGAACTAAGTTCTTTGCAAATTGCAACTAATTTCTTTTCCGAGGCGAATAAACTCGGCAATGGAGGGTTTGGGCCCGTCTACAAGGCATTGTTCTTGGAAGTTGAAATGTTGAATATCTTCGTTCTGTTTTCTCATTTTCGACTCTGA ATGAGAAAGTTCAATTCCATACCAACTTCTCATTGCCTCTCTGATTCTGGCGTCAACTTGACCGGTCGGAACTTCCATCCCCGTCAGAACGAGCTCATCGGCGCAATCACCCAAGCTCTGCCTGGCGGCGTTAAAAGACTTAAAGCAGCTAATTCTGCGAGTGACGATGAAGCGGATGATGAAGATGTATCCACTGACATCTTCTTTGAACTAAGTTCTTTGCAAATTGCAACTAATTTCTTTTCCGAGGCGAATAAACTCGGCAATGGAGGGTTTGGGCCCGTCTACAAGGCATTGTTCTTGGAAGTTGAAATGTTGAATATCTTCGTTCTGTTTTCTCATTTTCGACTCTGA MRKFNSIPTSHCLSDSGVNLTGRNFHPRQNELIGAITQALPGGVKRLKAANSASDDEADDEDVSTDIFFELSSLQIATNFFSEANKLGNGGFGPVYKALFLEVEMLNIFVLFSHFRL
BLAST of ClCG04G011060 vs. Swiss-Prot
Match: Y1155_ARATH (G-type lectin S-receptor-like serine/threonine-protein kinase At1g61550 OS=Arabidopsis thaliana GN=At1g61550 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.4e-06 Identity = 25/42 (59.52%), Postives = 29/42 (69.05%), Query Frame = 1
BLAST of ClCG04G011060 vs. Swiss-Prot
Match: SD129_ARATH (G-type lectin S-receptor-like serine/threonine-protein kinase SD1-29 OS=Arabidopsis thaliana GN=SD129 PE=1 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 4.0e-06 Identity = 25/58 (43.10%), Postives = 36/58 (62.07%), Query Frame = 1
BLAST of ClCG04G011060 vs. Swiss-Prot
Match: Y1146_ARATH (G-type lectin S-receptor-like serine/threonine-protein kinase At1g61460 OS=Arabidopsis thaliana GN=At1g61460 PE=2 SV=4) HSP 1 Score: 52.4 bits (124), Expect = 4.0e-06 Identity = 27/59 (45.76%), Postives = 36/59 (61.02%), Query Frame = 1
BLAST of ClCG04G011060 vs. TrEMBL
Match: A0A0A0LVR8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G042380 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 4.5e-25 Identity = 71/125 (56.80%), Postives = 79/125 (63.20%), Query Frame = 1
BLAST of ClCG04G011060 vs. TrEMBL
Match: D7SJ08_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_17s0000g03510 PE=4 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 7.0e-10 Identity = 35/57 (61.40%), Postives = 43/57 (75.44%), Query Frame = 1
BLAST of ClCG04G011060 vs. TrEMBL
Match: M5WAQ6_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa006449mg PE=4 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 9.2e-10 Identity = 38/59 (64.41%), Postives = 45/59 (76.27%), Query Frame = 1
BLAST of ClCG04G011060 vs. TrEMBL
Match: B9T632_RICCO (Serine-threonine protein kinase, plant-type, putative OS=Ricinus communis GN=RCOM_1198000 PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 1.2e-09 Identity = 35/56 (62.50%), Postives = 43/56 (76.79%), Query Frame = 1
BLAST of ClCG04G011060 vs. TrEMBL
Match: A0A061FUX1_THECC (Cysteine-rich RLK 29 isoform 1 OS=Theobroma cacao GN=TCM_012367 PE=4 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.7e-09 Identity = 33/50 (66.00%), Postives = 40/50 (80.00%), Query Frame = 1
BLAST of ClCG04G011060 vs. TAIR10
Match: AT1G61475.1 (AT1G61475.1 ATP binding;protein kinases) HSP 1 Score: 54.3 bits (129), Expect = 5.9e-08 Identity = 28/55 (50.91%), Postives = 35/55 (63.64%), Query Frame = 1
BLAST of ClCG04G011060 vs. TAIR10
Match: AT1G61550.1 (AT1G61550.1 S-locus lectin protein kinase family protein) HSP 1 Score: 53.9 bits (128), Expect = 7.7e-08 Identity = 25/42 (59.52%), Postives = 29/42 (69.05%), Query Frame = 1
BLAST of ClCG04G011060 vs. TAIR10
Match: AT1G61380.1 (AT1G61380.1 S-domain-1 29) HSP 1 Score: 52.4 bits (124), Expect = 2.2e-07 Identity = 25/58 (43.10%), Postives = 36/58 (62.07%), Query Frame = 1
BLAST of ClCG04G011060 vs. TAIR10
Match: AT1G61460.1 (AT1G61460.1 S-locus protein kinase, putative) HSP 1 Score: 52.4 bits (124), Expect = 2.2e-07 Identity = 27/59 (45.76%), Postives = 36/59 (61.02%), Query Frame = 1
BLAST of ClCG04G011060 vs. TAIR10
Match: AT1G61480.1 (AT1G61480.1 S-locus lectin protein kinase family protein) HSP 1 Score: 50.4 bits (119), Expect = 8.5e-07 Identity = 24/49 (48.98%), Postives = 34/49 (69.39%), Query Frame = 1
BLAST of ClCG04G011060 vs. NCBI nr
Match: gi|700209030|gb|KGN64126.1| (hypothetical protein Csa_1G042380 [Cucumis sativus]) HSP 1 Score: 122.1 bits (305), Expect = 6.5e-25 Identity = 71/125 (56.80%), Postives = 79/125 (63.20%), Query Frame = 1
BLAST of ClCG04G011060 vs. NCBI nr
Match: gi|659066736|ref|XP_008458735.1| (PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform X1 [Cucumis melo]) HSP 1 Score: 99.8 bits (247), Expect = 3.5e-18 Identity = 48/55 (87.27%), Postives = 52/55 (94.55%), Query Frame = 1
BLAST of ClCG04G011060 vs. NCBI nr
Match: gi|449439411|ref|XP_004137479.1| (PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform X1 [Cucumis sativus]) HSP 1 Score: 97.8 bits (242), Expect = 1.3e-17 Identity = 47/55 (85.45%), Postives = 50/55 (90.91%), Query Frame = 1
BLAST of ClCG04G011060 vs. NCBI nr
Match: gi|778657257|ref|XP_011650554.1| (PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform X2 [Cucumis sativus]) HSP 1 Score: 97.8 bits (242), Expect = 1.3e-17 Identity = 47/55 (85.45%), Postives = 50/55 (90.91%), Query Frame = 1
BLAST of ClCG04G011060 vs. NCBI nr
Match: gi|225455972|ref|XP_002278538.1| (PREDICTED: cysteine-rich receptor-like protein kinase 8 [Vitis vinifera]) HSP 1 Score: 71.6 bits (174), Expect = 1.0e-09 Identity = 35/57 (61.40%), Postives = 43/57 (75.44%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |